KEGG   Monosiga brevicollis: MONBRDRAFT_25473Help
Entry
MONBRDRAFT_25473  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
mbr  Monosiga brevicollis
Brite
Enzymes [BR:mbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     MONBRDRAFT_25473
Protein kinases [BR:mbr01001]
 Serine/threonine protein kinases: Other group
  TTK family
   MONBRDRAFT_25473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1083 aa AA seqDB search
MESRAATMRALQATIEATLESFEVRYSAKNDQAAIPNLRPARPRAGLGSALRIKSASQRM
TELQTDGNPLEGWWSFLNLQLDSLKGPCQHLLRFYKTGIERIDQERYRDQELYVQLWLEY
ARLAMACGDAEEAGFTFQQMQQDSIGRGFRHFHTIWAEFEESQGHTGRSLEILRKGRTAR
KPSSEIVARESRFKCLLETPTSCIRCGGRSKRYNNDQSTDPTPMKRPAPTRQATRRQAAS
RAAAFGPPQRVPLSTSIVEEEDDDEDKANAKEQARPHNHSRSSKESEALMNDDLGLPSVD
PVKARLAQALSANTSAANLSSDSNLPHLTTSSLGSNGSRLSISSVGSADDATNNGSGSDN
SFSDIQPGRHARDPERRTGANRPSGLQHCDAPVDRPHSSPRAPLEAPMPAPAPHSAAAGA
PKRQHATLTVRPDVDEDPLPPPLPMASTSKQATAVSSPGKGQAHGPTTAAPGPTGDTVKF
SLKSRVHEVQARDELPIATPMGVPRPKSRHQTALPAPSTVEAAPPVARRMASAAATPSAA
PASMRHQPVSDEFVRNMETVSVAQRPYIKLEQLGKGGSSRVYRVLDAEHAMLALKEVDLR
DVDAATVASFKNEIHLLERLQGEPNIICLVDWEHDEVAKVLRIVMECGDVDLARMLQTQR
AARASSRGAELPVIDENHIRLYFQQMLEAVGAVHRQQIVHSDLKPANFLCVKGALKLIDF
GIATGIQEDHTSVMRDAQIGTVNYMSPEAIAGTMGDGACLKVGPASDVWSLGCILYLMVY
GKTPFQHMPVLQKLQRIPDAKHAIEFEPLANRDLLAALQACLQRNPKKRPTIEQLLAHPF
LHPGTAAGPALQTPRRDRSHSRLGGAVPYAELDGESTATVTQAQLMQLLSQVRQLDVQCS
PGRLSRRIFRQLQQGVTMESLNVAATPARPRAGPTGAAPLRTPLGKLDGNSMRPNTGMKR
GKVKLQTASPLVLGAYTTTLGQSGLREQTKTRPIEKDYALCLHLEPTNRFTYRYPNCRPN
CSNDPTILVCSTVPHPTFSSSRALALSTLHTLALALYLSRSLSLSLNNNNKNNENTIMHT
TLY
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgcgcgcggcgaccatgcgcgccctccaggccaccattgaggcgaccctggag
tcgttcgaggtacgatattctgccaaaaacgatcaggctgccattcccaacctgcgcccg
gcgcgacctcgcgcaggtctaggcagtgcacttcgaatcaagtcggcgtctcagcgcatg
acagaactgcaaacggacggcaatccccttgagggctggtggtctttcttgaaccttcag
ctcgacagtctcaagggcccctgccaacatcttctgcgtttctacaagacaggaattgaa
cgcatcgatcaagagcgctaccgcgaccaagaactctacgttcaactctggctcgaatat
gcgcgcctggccatggcctgcggtgacgctgaagaggctggcttcactttccagcaaatg
cagcaagatagcattggtcgtggcttccggcattttcacaccatttgggcagaatttgaa
gaaagccaaggccatacgggccggtcgctcgaaattctgcgcaaggggcgcaccgctcga
aaaccctccagcgaaattgtggcccgcgaatcccgattcaaatgcttgctggagacccca
acctcctgcattcgttgcggagggcgctccaaacgctacaacaacgaccaatccaccgac
cccacacccatgaagcggcccgcccctacccggcaagccactcgccgccaagcagccagc
cgtgctgctgcatttggtccaccccagcgggtcccgctcagcacctccattgtggaggag
gaagacgacgacgaggataaagccaacgccaaagaacaagctcgcccacacaaccacagt
cgcagctcgaaagaaagcgaagcccttatgaacgatgacctgggactacccagcgtggat
cccgtgaaagcgcgactggctcaggccttgagcgccaacacctcggcggcaaacctgtcc
agcgacagcaatctacctcacctcaccacctcaagtctcggtagcaatggcagtcgcctc
agcatctcgtccgtaggcagtgctgatgacgccaccaacaatggttctggtagtgacaac
agcttttctgacatccagcccggtcggcatgcgcgggacccagaacgtcgcaccggagcc
aatcgcccctcgggcttgcaacactgcgatgcccccgtggacaggccacactcttcccca
cgggccccgctggaagcacccatgcccgcgccggcacctcacagcgctgctgccggcgcg
cccaaacgtcagcatgctacgctgacggttcgacccgatgttgacgaagacccactccca
ccaccgctacccatggcatccacttccaaacaagccaccgctgtttcaagcccggggaag
gggcaggcgcacgggcccacaaccgctgcccctggaccaacgggtgacacagtcaagttc
tcgctcaagtcgcgagttcatgaggtgcaagctcgcgatgaactgcccatcgccaccccc
atgggcgtgccacggcccaagtctcgccaccaaaccgcgcttcctgccccatccactgtt
gaagccgccccgcccgtggcgcgtcgcatggcctctgccgccgccacgccctcagcggcg
cccgcgtccatgcgtcatcaacccgtctccgatgagtttgtgcgcaacatggaaaccgta
tcggtggctcagcgcccatacattaagttggagcaacttggtaaaggtggctcctcgcgc
gtctatcgcgtactcgatgctgagcacgccatgctggcgctcaaggaggtcgatttgcgc
gacgtggacgcggccaccgtggccagcttcaagaatgagattcacttgctcgagcgactg
cagggtgagcccaacattatctgcctcgtcgattgggagcacgacgaggtggccaaggtg
ctgcgcatcgtgatggagtgtggagacgttgacctcgcgaggatgctgcagacgcaacgc
gctgcacgggcctcgagccgtggcgcagagttgcccgtgatcgacgaaaatcacattcgc
ctgtattttcaacaaatgctcgaggccgtgggggctgtgcacaggcaacagattgtgcat
agcgatcttaagccggccaacttcctctgcgtcaaaggcgcactcaagctgattgacttt
ggtattgccacaggcattcaggaggaccataccagcgtgatgcgtgatgcgcagattggc
acggtcaactacatgtcccccgaggccattgctgggaccatgggcgatggcgcttgtctc
aaggttggtccagccagcgacgtctggtccctcgggtgcattctttacctgatggtctat
ggcaagacgccgtttcagcacatgccagtgctgcaaaagctgcagcgcattcccgacgcc
aagcacgcgattgagtttgagcccctggccaaccgagacctcttggccgcgctgcaagcc
tgtttacagcgcaaccctaagaagcgaccaacgatcgaacaattgctggcccatccgttt
ttgcatcctggcaccgccgctggaccggcgctgcaaacgccgcgccgtgataggagccac
agccgtctgggtggggccgtgccctacgcggagttggacggtgaatccacagccaccgtg
acccaagcgcaactcatgcagctcctcagccaggtgcgccagctggacgtgcaatgttcc
cctgggcgcttgtcgcgtcgtattttccgccagctccagcaaggcgtcacgatggagtca
ctcaatgtggcagcaaccccggcacggccgcgagctggaccgacaggagccgcacccctg
cgcaccccgttgggcaagctcgatggaaacagcatgcgacccaacacgggcatgaagcgt
ggcaaggtcaagcttcagaccgcctcgcccctcgttctcggtgcctacactaccaccctg
ggacagtcggggctgcgagagcagaccaaaacacgacccatagagaaagattacgccttg
tgcttgcatcttgagccaactaatcgattcacgtaccgctacccaaactgtcgacccaac
tgcagcaatgaccccacgatcctcgtgtgctccaccgttccccatcccaccttctcttct
tctcgcgccctcgctctctcgactttacacaccctggctctcgctctctacctctctcgc
tctctctctctctctctaaacaacaacaacaaaaataacgaaaacaccatcatgcacaca
actctatattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system