KEGG   Monosiga brevicollis: MONBRDRAFT_25571Help
Entry
MONBRDRAFT_25571  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
mbr  Monosiga brevicollis
Brite
Enzymes [BR:mbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     MONBRDRAFT_25571
Protein kinases [BR:mbr01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   MONBRDRAFT_25571
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 293 aa AA seqDB search
MYVCGGVIANSVLGVGGFGRVDLVYAPQHQKQWALKAISKAAVLQSKQEVYVQSEREIMA
GLDSPFCTRLVATFKDDCYFYLLSEALLGGELWRHLKLGGPLAEDHARFYCACVLEGLAY
LHHRHILYRDLKPENVMLDARGYVKLVDFGFARHLPGNKKTWTFCGTPEYMAPEIIMNQG
HDQTCDYWAFGIFIYELLTSRTPFQHADPMQVYNKIVLGVDQIHCSPRLGCDAKDLVYRL
CRDVNADRLGTGIEGIMHIKHHIWFARVDWASLAQQCIPPPFVPDISKDDPTR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtgtgtgggggtgtaattgccaacagtgtgttaggtgtgggtggctttgggcgt
gtcgacctggtctatgccccacagcatcaaaagcaatgggccctgaaggccattagcaag
gccgccgttttgcaatccaagcaagaggtatacgtgcaatcagagcgcgagattatggcc
ggactggactcgcccttttgcacacggctagtcgcaaccttcaaagatgactgctatttc
tacctactgtctgaggcactactaggcggcgagctatggcgtcatctcaagctgggcggc
ccgctggctgaggatcacgctcgcttctattgcgcctgtgtccttgaaggcctggcctat
cttcatcatcggcacatcctgtaccgcgatctgaaacccgaaaatgtaatgcttgatgcc
cgtggctatgtcaagttggtggactttggctttgctcgccacctgccaggcaacaagaag
acctggaccttttgtggcaccccggagtacatggcaccagaaatcatcatgaatcaggga
cacgatcagacgtgcgactactgggcttttggcatctttatatacgagcttttgacaagc
aggaccccgtttcagcatgcggatcccatgcaagtgtacaacaagattgtcttgggagtg
gatcagatccactgtagcccgcggctcgggtgtgacgccaaagacctcgtttatcgtctc
tgcagagatgtcaatgcagaccgtttaggtacaggaatcgagggcatcatgcacataaag
caccacatttggtttgctcgggtagattgggccagtctagcccaacaatgtataccgcca
ccatttgtgcccgacatttccaaagacgatccaacacggtaa

DBGET integrated database retrieval system