KEGG   Monosiga brevicollis: MONBRDRAFT_26082Help
Entry
MONBRDRAFT_26082  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
mbr  Monosiga brevicollis
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:mbr03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:mbr03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 249 aa AA seqDB search
MTSIYHGISPTPSANALYFAIAYLQRYAVTTTLMEHHPDLICLTCWLLAVKASEAKVPLH
CLVAVAQRQPHTPLAQLAAKDVEDQVRQLESSLAQKLNYEFYVSLPSRAMRAILIELQGV
TDPAPPAVDDEKSIMAALLNLWASPAQLQMAPVQLCLAALGRVRGVAAVAAYLQRVQPEA
SSEALARAEAIAKKVEAAAGTPPPDSDFMRLLDKVDKCLNPFLDPRTPEFATLQKLKREK
AKRSAEAAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccatttaccacggcatcagtcccacgccctcagccaacgccctctactttgcc
atagcttatctgcagcgctatgccgttaccacgaccctaatggagcatcaccctgacctc
atctgcctgacgtgctggctcttggccgtcaaggcctccgaggccaaagtgccactccac
tgcctcgttgcggtggcgcagcggcaaccgcacacaccattggctcagctcgcggccaag
gacgtggaagaccaagtgcgtcaacttgagtcttcacttgcgcaaaaactgaattacgag
ttttacgtttccttgccctcgcgtgccatgcgtgccatcctgattgagctacaaggcgtg
accgaccctgccccgcctgcggtggatgatgagaagagcatcatggctgccctgctcaac
ctgtgggccagccccgctcaactacagatggcgccggtccagctatgccttgcagcgttg
ggccgcgtacgtggagtggctgccgtcgcagcgtatctgcaacgagtccaaccagaagcc
agctcagaggcgctggcccgggctgaagccattgcaaaaaaagttgaggcagctgcagga
actccgcctcctgattcagactttatgaggttgctggacaaggtggacaagtgtctcaac
cctttcctggaccctcggactcccgagtttgcgacccttcaaaagctgaagcgcgagaaa
gcgaagcgttcagctgaggcggctgcctga

DBGET integrated database retrieval system