KEGG   Monosiga brevicollis: MONBRDRAFT_26082Help
Entry
MONBRDRAFT_26082  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
mbr  Monosiga brevicollis
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    MONBRDRAFT_26082
  Replication and repair
   03420 Nucleotide excision repair
    MONBRDRAFT_26082
Transcription machinery [BR:mbr03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     MONBRDRAFT_26082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 249 aa AA seqDB search
MTSIYHGISPTPSANALYFAIAYLQRYAVTTTLMEHHPDLICLTCWLLAVKASEAKVPLH
CLVAVAQRQPHTPLAQLAAKDVEDQVRQLESSLAQKLNYEFYVSLPSRAMRAILIELQGV
TDPAPPAVDDEKSIMAALLNLWASPAQLQMAPVQLCLAALGRVRGVAAVAAYLQRVQPEA
SSEALARAEAIAKKVEAAAGTPPPDSDFMRLLDKVDKCLNPFLDPRTPEFATLQKLKREK
AKRSAEAAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccatttaccacggcatcagtcccacgccctcagccaacgccctctactttgcc
atagcttatctgcagcgctatgccgttaccacgaccctaatggagcatcaccctgacctc
atctgcctgacgtgctggctcttggccgtcaaggcctccgaggccaaagtgccactccac
tgcctcgttgcggtggcgcagcggcaaccgcacacaccattggctcagctcgcggccaag
gacgtggaagaccaagtgcgtcaacttgagtcttcacttgcgcaaaaactgaattacgag
ttttacgtttccttgccctcgcgtgccatgcgtgccatcctgattgagctacaaggcgtg
accgaccctgccccgcctgcggtggatgatgagaagagcatcatggctgccctgctcaac
ctgtgggccagccccgctcaactacagatggcgccggtccagctatgccttgcagcgttg
ggccgcgtacgtggagtggctgccgtcgcagcgtatctgcaacgagtccaaccagaagcc
agctcagaggcgctggcccgggctgaagccattgcaaaaaaagttgaggcagctgcagga
actccgcctcctgattcagactttatgaggttgctggacaaggtggacaagtgtctcaac
cctttcctggaccctcggactcccgagtttgcgacccttcaaaagctgaagcgcgagaaa
gcgaagcgttcagctgaggcggctgcctga

DBGET integrated database retrieval system