KEGG   Monosiga brevicollis: MONBRDRAFT_26458Help
Entry
MONBRDRAFT_26458  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
mbr  Monosiga brevicollis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MONBRDRAFT_26458
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MONBRDRAFT_26458
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MONBRDRAFT_26458
Enzymes [BR:mbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MONBRDRAFT_26458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 676 aa AA seqDB search
MAVAIRQAFARCQRLGKPAFVGFLTAGFPTLDTTIPALVALQEGGADIIELGLPFSDPLA
DGGAIQKANTQALANGMTVPKLVQLIADARKAGVTVPIVIMGYFNPMMAYGFERFAKDVA
EAGGNGFIIVDLPPEQASSALEAINRHDLGFVPLVTPTTTDERMAKLASIGNCFIYCVSV
TGVTGARTNLAEDLPDFIARVRKHTQLPLAVGFGISKREHVVTVGQNADGAVVGSAIIAA
VDSLGPEASPADRAQQVQALIQDLTQGKTHAEGEDEAMDKIVVDGFSYGAFGGRYIPETL
VEAHEQLWEAWQEAWKDPAFHEELAHLRSKYVGGPTPLWKCERLSQACGGGEIWLKREDL
AHTGAHKINNALGQVLLAKRLNKERLIAETGAGQHGVAMATACALMGIKCVVYMGEEDTQ
RQSLNVFRMKMLGAEVVAVKSGSRTLKDAINEAMRDWVTNVRTTHYCLGSAVGPHPFPLI
VRDLQCVIGREARTEFLETTGSLPDAVIACVGGGSNAIGMFHPFVGDEGVRLIGVEAGGE
HGVEGGKHSASLVAGKPGVLHGTLTYLLQDTDGQITETHSISAGLDYPGVGPEHSFLKDS
GRAEYVAITDSEALDAFKQLSQLEGIIPALESSHAVAYGMKLAKTMKPGQRVLVNLSGRG
DKDMMTVAKVMGVQLD
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcgccatccgtcaagcgtttgcccgctgccagcggctgggcaagcccgccttt
gtcgggtttctgaccgctggctttccgacgttggacaccaccatcccggctcttgtggct
cttcaggagggcggtgccgacatcatcgagctgggtttgcccttctccgaccctttggcc
gatggcggggctatccaaaaggccaatacccaagccttggccaacggcatgaccgtaccc
aaactggtgcaactcattgccgacgcgcgcaaggcgggtgtgactgtgcccattgttatc
atgggctacttcaacccgatgatggcctacggcttcgagcgctttgccaaggacgtagct
gaggctggtggcaacggctttatcattgtagatctgccgcccgagcaagcaagcagtgcc
ttagaggccatcaatcgccacgatcttggctttgtgccgctggtgacacccaccacgacg
gatgaacgcatggccaaacttgcctccattggcaactgcttcatttactgtgtgagcgtt
actggcgtaactggtgcgcgcaccaatttggctgaagacttgcccgactttattgcccgt
gtgcgcaagcatactcaattgcctctggccgtgggctttggcattagcaagcgtgagcac
gtggtcacggtcgggcaaaatgctgatggcgctgttgtggggtcggcgatcatcgccgcc
gtggatagccttggtcctgaggcttcaccggcggatcgggcacaacaagttcaagctctc
atccaagacttgacgcagggcaagacccatgccgagggtgaagacgaggcgatggacaag
attgtggttgatggcttcagctatggtgcttttggggggcgctacatccccgagaccctg
gttgaagcccacgagcagctctgggaggcctggcaggaggcttggaaggacccagctttc
cacgaggaactggcgcaccttcgctcgaaatatgttggtggacccacacccctttggaag
tgtgagcggctcagccaagcctgcggcgggggtgaaatttggctcaagcgtgaagatttg
gcgcacaccggtgcgcataagattaataacgcgttgggccaggtgctgctcgccaagcgt
ctcaataaggagcgattgatcgccgagactggtgccggtcaacatggagtggccatggcg
acggcctgcgcccttatgggcatcaagtgtgtcgtgtacatgggtgaagaagacacgcaa
cgccagtcactcaacgtctttcgaatgaagatgctcggggccgaggtcgtggctgtcaag
tctgggtcgcgcacgctcaaggatgctatcaacgaggccatgcgtgattgggtgaccaac
gtgcgcaccacccattactgcctcggatcggctgtgggcccacatccttttcccttgatt
gtacgcgacctgcaatgcgtcattggtcgcgaagcgcgcacggagtttttggagaccaca
ggttctctgcccgatgcggtcattgcttgcgttgggggtggttccaacgccatcggcatg
ttccatccctttgtcggggacgaaggtgtgcgcttgatcggcgtggaggctggtggtgag
cacggcgtggaagggggcaagcactcggcctccctggtcgcgggcaagcccggtgtgctg
cacggcacgttgacctacctcttgcaggacacggatggacaaatcacggagacgcatagc
atctcggccggtctcgactacccgggtgtgggcccagagcactccttcctcaaggatagt
ggccgagccgagtatgtggccattacggacagcgaggccttggatgccttcaagcagttg
tcgcagctggagggtatcatcccagctctcgagtcgagccacgccgtggcctatggcatg
aagttggccaagacgatgaagcctgggcagcgcgtgctggtcaacctttcgggccgtggc
gataaggacatgatgactgtggccaaggtcatgggagtgcagctggattga

DBGET integrated database retrieval system