KEGG   Monosiga brevicollis: MONBRDRAFT_26458Help
Entry
MONBRDRAFT_26458  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
mbr  Monosiga brevicollis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MONBRDRAFT_26458
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MONBRDRAFT_26458
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MONBRDRAFT_26458
Enzymes [BR:mbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MONBRDRAFT_26458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 676 aa AA seqDB search
MAVAIRQAFARCQRLGKPAFVGFLTAGFPTLDTTIPALVALQEGGADIIELGLPFSDPLA
DGGAIQKANTQALANGMTVPKLVQLIADARKAGVTVPIVIMGYFNPMMAYGFERFAKDVA
EAGGNGFIIVDLPPEQASSALEAINRHDLGFVPLVTPTTTDERMAKLASIGNCFIYCVSV
TGVTGARTNLAEDLPDFIARVRKHTQLPLAVGFGISKREHVVTVGQNADGAVVGSAIIAA
VDSLGPEASPADRAQQVQALIQDLTQGKTHAEGEDEAMDKIVVDGFSYGAFGGRYIPETL
VEAHEQLWEAWQEAWKDPAFHEELAHLRSKYVGGPTPLWKCERLSQACGGGEIWLKREDL
AHTGAHKINNALGQVLLAKRLNKERLIAETGAGQHGVAMATACALMGIKCVVYMGEEDTQ
RQSLNVFRMKMLGAEVVAVKSGSRTLKDAINEAMRDWVTNVRTTHYCLGSAVGPHPFPLI
VRDLQCVIGREARTEFLETTGSLPDAVIACVGGGSNAIGMFHPFVGDEGVRLIGVEAGGE
HGVEGGKHSASLVAGKPGVLHGTLTYLLQDTDGQITETHSISAGLDYPGVGPEHSFLKDS
GRAEYVAITDSEALDAFKQLSQLEGIIPALESSHAVAYGMKLAKTMKPGQRVLVNLSGRG
DKDMMTVAKVMGVQLD
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcgccatccgtcaagcgtttgcccgctgccagcggctgggcaagcccgccttt
gtcgggtttctgaccgctggctttccgacgttggacaccaccatcccggctcttgtggct
cttcaggagggcggtgccgacatcatcgagctgggtttgcccttctccgaccctttggcc
gatggcggggctatccaaaaggccaatacccaagccttggccaacggcatgaccgtaccc
aaactggtgcaactcattgccgacgcgcgcaaggcgggtgtgactgtgcccattgttatc
atgggctacttcaacccgatgatggcctacggcttcgagcgctttgccaaggacgtagct
gaggctggtggcaacggctttatcattgtagatctgccgcccgagcaagcaagcagtgcc
ttagaggccatcaatcgccacgatcttggctttgtgccgctggtgacacccaccacgacg
gatgaacgcatggccaaacttgcctccattggcaactgcttcatttactgtgtgagcgtt
actggcgtaactggtgcgcgcaccaatttggctgaagacttgcccgactttattgcccgt
gtgcgcaagcatactcaattgcctctggccgtgggctttggcattagcaagcgtgagcac
gtggtcacggtcgggcaaaatgctgatggcgctgttgtggggtcggcgatcatcgccgcc
gtggatagccttggtcctgaggcttcaccggcggatcgggcacaacaagttcaagctctc
atccaagacttgacgcagggcaagacccatgccgagggtgaagacgaggcgatggacaag
attgtggttgatggcttcagctatggtgcttttggggggcgctacatccccgagaccctg
gttgaagcccacgagcagctctgggaggcctggcaggaggcttggaaggacccagctttc
cacgaggaactggcgcaccttcgctcgaaatatgttggtggacccacacccctttggaag
tgtgagcggctcagccaagcctgcggcgggggtgaaatttggctcaagcgtgaagatttg
gcgcacaccggtgcgcataagattaataacgcgttgggccaggtgctgctcgccaagcgt
ctcaataaggagcgattgatcgccgagactggtgccggtcaacatggagtggccatggcg
acggcctgcgcccttatgggcatcaagtgtgtcgtgtacatgggtgaagaagacacgcaa
cgccagtcactcaacgtctttcgaatgaagatgctcggggccgaggtcgtggctgtcaag
tctgggtcgcgcacgctcaaggatgctatcaacgaggccatgcgtgattgggtgaccaac
gtgcgcaccacccattactgcctcggatcggctgtgggcccacatccttttcccttgatt
gtacgcgacctgcaatgcgtcattggtcgcgaagcgcgcacggagtttttggagaccaca
ggttctctgcccgatgcggtcattgcttgcgttgggggtggttccaacgccatcggcatg
ttccatccctttgtcggggacgaaggtgtgcgcttgatcggcgtggaggctggtggtgag
cacggcgtggaagggggcaagcactcggcctccctggtcgcgggcaagcccggtgtgctg
cacggcacgttgacctacctcttgcaggacacggatggacaaatcacggagacgcatagc
atctcggccggtctcgactacccgggtgtgggcccagagcactccttcctcaaggatagt
ggccgagccgagtatgtggccattacggacagcgaggccttggatgccttcaagcagttg
tcgcagctggagggtatcatcccagctctcgagtcgagccacgccgtggcctatggcatg
aagttggccaagacgatgaagcctgggcagcgcgtgctggtcaacctttcgggccgtggc
gataaggacatgatgactgtggccaaggtcatgggagtgcagctggattga

DBGET integrated database retrieval system