KEGG   Monosiga brevicollis: MONBRDRAFT_26458Help
Entry
MONBRDRAFT_26458  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
mbr  Monosiga brevicollis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mbr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mbr00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mbr00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 676 aa AA seqDB search
MAVAIRQAFARCQRLGKPAFVGFLTAGFPTLDTTIPALVALQEGGADIIELGLPFSDPLA
DGGAIQKANTQALANGMTVPKLVQLIADARKAGVTVPIVIMGYFNPMMAYGFERFAKDVA
EAGGNGFIIVDLPPEQASSALEAINRHDLGFVPLVTPTTTDERMAKLASIGNCFIYCVSV
TGVTGARTNLAEDLPDFIARVRKHTQLPLAVGFGISKREHVVTVGQNADGAVVGSAIIAA
VDSLGPEASPADRAQQVQALIQDLTQGKTHAEGEDEAMDKIVVDGFSYGAFGGRYIPETL
VEAHEQLWEAWQEAWKDPAFHEELAHLRSKYVGGPTPLWKCERLSQACGGGEIWLKREDL
AHTGAHKINNALGQVLLAKRLNKERLIAETGAGQHGVAMATACALMGIKCVVYMGEEDTQ
RQSLNVFRMKMLGAEVVAVKSGSRTLKDAINEAMRDWVTNVRTTHYCLGSAVGPHPFPLI
VRDLQCVIGREARTEFLETTGSLPDAVIACVGGGSNAIGMFHPFVGDEGVRLIGVEAGGE
HGVEGGKHSASLVAGKPGVLHGTLTYLLQDTDGQITETHSISAGLDYPGVGPEHSFLKDS
GRAEYVAITDSEALDAFKQLSQLEGIIPALESSHAVAYGMKLAKTMKPGQRVLVNLSGRG
DKDMMTVAKVMGVQLD
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcgccatccgtcaagcgtttgcccgctgccagcggctgggcaagcccgccttt
gtcgggtttctgaccgctggctttccgacgttggacaccaccatcccggctcttgtggct
cttcaggagggcggtgccgacatcatcgagctgggtttgcccttctccgaccctttggcc
gatggcggggctatccaaaaggccaatacccaagccttggccaacggcatgaccgtaccc
aaactggtgcaactcattgccgacgcgcgcaaggcgggtgtgactgtgcccattgttatc
atgggctacttcaacccgatgatggcctacggcttcgagcgctttgccaaggacgtagct
gaggctggtggcaacggctttatcattgtagatctgccgcccgagcaagcaagcagtgcc
ttagaggccatcaatcgccacgatcttggctttgtgccgctggtgacacccaccacgacg
gatgaacgcatggccaaacttgcctccattggcaactgcttcatttactgtgtgagcgtt
actggcgtaactggtgcgcgcaccaatttggctgaagacttgcccgactttattgcccgt
gtgcgcaagcatactcaattgcctctggccgtgggctttggcattagcaagcgtgagcac
gtggtcacggtcgggcaaaatgctgatggcgctgttgtggggtcggcgatcatcgccgcc
gtggatagccttggtcctgaggcttcaccggcggatcgggcacaacaagttcaagctctc
atccaagacttgacgcagggcaagacccatgccgagggtgaagacgaggcgatggacaag
attgtggttgatggcttcagctatggtgcttttggggggcgctacatccccgagaccctg
gttgaagcccacgagcagctctgggaggcctggcaggaggcttggaaggacccagctttc
cacgaggaactggcgcaccttcgctcgaaatatgttggtggacccacacccctttggaag
tgtgagcggctcagccaagcctgcggcgggggtgaaatttggctcaagcgtgaagatttg
gcgcacaccggtgcgcataagattaataacgcgttgggccaggtgctgctcgccaagcgt
ctcaataaggagcgattgatcgccgagactggtgccggtcaacatggagtggccatggcg
acggcctgcgcccttatgggcatcaagtgtgtcgtgtacatgggtgaagaagacacgcaa
cgccagtcactcaacgtctttcgaatgaagatgctcggggccgaggtcgtggctgtcaag
tctgggtcgcgcacgctcaaggatgctatcaacgaggccatgcgtgattgggtgaccaac
gtgcgcaccacccattactgcctcggatcggctgtgggcccacatccttttcccttgatt
gtacgcgacctgcaatgcgtcattggtcgcgaagcgcgcacggagtttttggagaccaca
ggttctctgcccgatgcggtcattgcttgcgttgggggtggttccaacgccatcggcatg
ttccatccctttgtcggggacgaaggtgtgcgcttgatcggcgtggaggctggtggtgag
cacggcgtggaagggggcaagcactcggcctccctggtcgcgggcaagcccggtgtgctg
cacggcacgttgacctacctcttgcaggacacggatggacaaatcacggagacgcatagc
atctcggccggtctcgactacccgggtgtgggcccagagcactccttcctcaaggatagt
ggccgagccgagtatgtggccattacggacagcgaggccttggatgccttcaagcagttg
tcgcagctggagggtatcatcccagctctcgagtcgagccacgccgtggcctatggcatg
aagttggccaagacgatgaagcctgggcagcgcgtgctggtcaacctttcgggccgtggc
gataaggacatgatgactgtggccaaggtcatgggagtgcagctggattga

DBGET integrated database retrieval system