KEGG   Monosiga brevicollis: MONBRDRAFT_26465Help
Entry
MONBRDRAFT_26465  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K00213  7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00100  Steroid biosynthesis
mbr01100  Metabolic pathways
mbr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    MONBRDRAFT_26465
Enzymes [BR:mbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     MONBRDRAFT_26465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERG4_ERG24
Motif
Other DBs
NCBI-GeneID: 5892043
NCBI-ProteinID: XP_001746961
JGI: 26465
UniProt: A9V2F9
AA seq 530 aa AA seqDB search
MAPTKPDTRPSFWNLADLRSATLPLLLMIWSMGSMPLLLEAVEHRRGNLLAAFQALMTNP
HVRARQFTVEIWAVGAIAAFGLSQVIGMIIFDRLARCKPYFGPALPDGSNKRARHPKLGP
FQSCFTWAVVVAGYFCYMANVEPGDVLFVDVYPDLIRASTVIGFSVALFLYARACIWPTC
PVAKAPKLTLGGIIEQFYSGLELYPSFDGRNLQIKNWTNCRWGMTLWLIFASLFALDNFK
RNDGMTWGMLAHTTVMHAYLFKFFWWEHGYYHTLDIMHDRVGYYLAYGCISFLPLVYLTP
SYAMASKLGETSTPFVAYLSIVCGIASMVINYGIDLQKTQFKNDGTISWLGFGRRPASFI
SDGKRRLLVDGFWTARKINYTFELLLTFFWTLPAGITSWVPWYYLMYLTVLLTHRIYRDE
ARCASKYGELWTRYKERVPGVLIPTQFTMTTLAPKIAHTVHHGAQEVVQKVEEKTHKASG
RAHRLFSSDEFTGQPGPNDQVLSRTRNVSHYPDGDWQITERVIYRLQSAS
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgacaaagcccgacacgcggccgtccttctggaacctggccgacctgcgtagt
gctacactgcctctcttgcttatgatctggagcatgggctccatgcccttgctgttggaa
gccgttgaacaccgtcgaggcaatctcctggctgcctttcaggccttaatgaccaacccc
catgtgcgcgcccgccagttcaccgttgaaatttgggccgttggtgccatcgctgccttt
ggcctttcccaagtcattggcatgatcatctttgaccgccttgcgcgctgcaagccgtat
tttggaccagccttgccagacggctccaacaagcgtgcccggcatcccaagctcggcccg
ttccagtcctgcttcacctgggctgtggtcgtggctggctacttttgctacatggccaac
gtggaacccggtgatgtgctgtttgtggacgtctaccctgatctgattcgcgccagcacc
gtcattggattttcggtagccctgtttctctacgcccgggcttgtatttggcccacatgc
cccgtggccaaggcccccaaactgacgttgggtggcatcatcgaacaattttattccggc
ctcgagctgtatccatcattcgatggccgcaatcttcagatcaagaattggaccaactgc
cgctggggcatgacgctgtggctcatttttgcctccttgtttgctctggataacttcaag
cgaaacgacggcatgacgtggggcatgttggcccacacaacagtcatgcatgcatatctc
ttcaagttcttctggtgggagcacggctactaccacacgctggatatcatgcatgatcgc
gtcggctattacctggcctatgggtgcatttccttccttccccttgtctatttgacacct
tcgtatgccatggccagcaagcttggcgaaacatccaccccctttgtggcctacctcagc
atcgtctgtggaatcgcctcaatggtaattaattacggcattgatctgcaaaagactcag
ttcaagaacgatggcaccatctcttggctgggctttggtcgtcgaccagccagctttatc
tcggacggcaaacggcgactgctggtggacggcttttggacggctcgcaagatcaattac
acgtttgagctgctgctcacttttttctggacgctgccggcgggtattacctcctgggtc
ccctggtactacctcatgtacctgactgtgctcttgacccatcgtatttaccgtgacgag
gctcggtgtgccagcaaatacggtgagctgtggactcgctacaaggagcgtgtgcccggg
gttttgatccccactcaattcaccatgacgactctggcacccaagattgctcacaccgtt
catcatggcgcacaagaggtggttcagaaggttgaagaaaagacgcacaaagcctctgga
cgtgcccatcgtctgtttagtagcgatgaatttacgggtcagcccgggcccaacgaccag
gtgctttctcgcacccgcaatgtctcccactatccagatggcgactggcaaatcactgag
cgcgtgatctaccgcctgcaatcggcgagttaa

DBGET integrated database retrieval system