KEGG   Monosiga brevicollis: MONBRDRAFT_26640Help
Entry
MONBRDRAFT_26640  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
mbr  Monosiga brevicollis
Brite
Chromosome [BR:mbr03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    MONBRDRAFT_26640
Exosome [BR:mbr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MONBRDRAFT_26640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa CENP-T_C Imm71
Motif
Other DBs
NCBI-GeneID: 5892308
NCBI-ProteinID: XP_001747040
JGI: 26640
UniProt: A9UY62
AA seq 120 aa AA seqDB search
MPPKASKKGEKKAGKAKAVGEKGRKKRRKESYSIYIFKVLKQVHSDTGVSSKAMSILNSF
VNDLFERIANESSRLAKYNGKSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaaggcttccaagaagggcgagaagaaggccggcaaggccaaggccgtcggc
gagaagggtcgcaagaagcgccgcaaggagtcttactccatctacatcttcaaggtcctg
aagcaggtgcactctgataccggtgtttcctccaaggccatgtccatcctcaactcgttt
gtcaacgacctctttgagcgcattgccaacgagtcgtcccgtctggccaagtacaacggc
aagtccaccatctcgtcccgcgagatccagaccgccgtccgcctcttgctccccggtgag
ctggccaagcacgccgtctctgagggcaccaaggccgtcaccaagtacaccagcagcaag
taa

DBGET integrated database retrieval system