KEGG   Monosiga brevicollis: MONBRDRAFT_26640Help
Entry
MONBRDRAFT_26640  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
mbr  Monosiga brevicollis
Brite
Exosome [BR:mbr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MONBRDRAFT_26640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 120 aa AA seqDB search
MPPKASKKGEKKAGKAKAVGEKGRKKRRKESYSIYIFKVLKQVHSDTGVSSKAMSILNSF
VNDLFERIANESSRLAKYNGKSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaaggcttccaagaagggcgagaagaaggccggcaaggccaaggccgtcggc
gagaagggtcgcaagaagcgccgcaaggagtcttactccatctacatcttcaaggtcctg
aagcaggtgcactctgataccggtgtttcctccaaggccatgtccatcctcaactcgttt
gtcaacgacctctttgagcgcattgccaacgagtcgtcccgtctggccaagtacaacggc
aagtccaccatctcgtcccgcgagatccagaccgccgtccgcctcttgctccccggtgag
ctggccaagcacgccgtctctgagggcaccaaggccgtcaccaagtacaccagcagcaag
taa

DBGET integrated database retrieval system