KEGG   Monosiga brevicollis: MONBRDRAFT_26688Help
Entry
MONBRDRAFT_26688  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mbr  Monosiga brevicollis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MONBRDRAFT_26688
Enzymes [BR:mbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MONBRDRAFT_26688
Exosome [BR:mbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MONBRDRAFT_26688
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 377 aa AA seqDB search
MAAEVPEPRVEFPLQGGYHNPTLRAWHATSAQLAKEHLMYPVFVSDHENSDHVEAIGSLP
EQNRYGYNAVVKALEPLVQKGLASVLLFGVVDRKDVRGATADDSDNPVVKVLPLLKAAFP
QLTVACDVCLCPYTDHGHCGIFMDTQPENESQQRFDPVASAKRIAEIAVAYAEAGCDIVA
PSDMMDGRIQAIDAGLKAKGLRNRVAIMSYSAKFCSCFYGPFRSRKHSRAWSTHETYSDA
AKSAPKTAPADQAEPATKVARRLVTPKGRHNYQLPPGSSGLAARANEISVREGADMLMVK
PGIAYLDVLRDTKRLHPYHPLAVYQVSGEYAMLWHGAAQGAVDLREGVLESMTAFRRAGA
DIIITYYAPRLLQWLDE
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggaagtgccagagccgcgggtcgagttcccactgcagggtggttaccacaac
ccgacgctgcgcgcgtggcatgcaacgagtgcgcagctggccaaggagcatttgatgtat
cccgtctttgtgagtgaccatgagaattctgatcacgtcgaagcgattggcagtttgccc
gagcaaaaccgctacggctacaatgctgtggttaaggcgctcgagcctttggttcagaag
ggactagcttctgtacttctctttggcgtcgttgaccgcaaggacgtgcgaggggccacg
gctgatgacagcgacaatccggtggtcaaggtgctgcccctcctcaaagctgccttccct
caactgacagtggcctgcgatgtgtgtttgtgtccctacacggaccatggccattgtggc
atcttcatggacacacagccagagaatgagagccagcagcgctttgaccccgtcgccagt
gccaagcggattgcggaaattgccgtggcctatgcagaggcagggtgcgacattgttgcg
ccctcagacatgatggacggccgtattcaagccatcgatgccggtcttaaagccaaaggc
ctgcgcaaccgtgtggccatcatgagctacagcgccaagttctgctcgtgcttctacggc
cctttccgctcccgcaagcactcacgggcttggtccactcatgaaacatacagcgatgcc
gcaaagtcagcgcccaagacggcccctgcagatcaagccgagcccgctaccaaggttgcc
cggcgtctcgtaacccccaagggccgtcacaactatcagttgccccctggcagcagcggt
cttgccgcccgtgccaacgagattagcgtccgcgagggtgctgacatgctcatggtcaag
cctggtatcgcttacctggacgtactgcgagacaccaagcgtctgcacccataccatccg
ctggcggtgtatcaagtttctggcgaatacgccatgctttggcatggtgctgctcagggc
gccgttgacctgcgtgagggggtgctcgagtccatgacggccttccgccgcgcgggggcc
gacatcatcatcacgtattacgcgccacgtctcctccagtggctggacgagtga

DBGET integrated database retrieval system