KEGG   Monosiga brevicollis: MONBRDRAFT_26880Help
Entry
MONBRDRAFT_26880  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
mbr  Monosiga brevicollis
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:mbr04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 826 aa AA seqDB search
MLDTPVAALEAAIQHSLDWFLYDNACFLAERLYYEAATDKATLLLGKCYFLSGQVRRAYQ
VLKKCPLPAARYLFARCCLDMRRAHLFTAAVLPSFQEGDLALIGLDMATEPQNLSRFTGH
NGAAEWLHGSLLLQANRKREATRLLRKSWEQNGYLFTSFDAICQLDDKPVDVQQGFQDQT
LATRLALANGQPHMRPMTSSTAVPSVTPRHNTATLPVATAVTSGTPKMLDESAASPPLQE
LDLSGMQSLPQTANATPASRRGRTRTAHVRQTLSFDSPAESQPSTLASAAKAKPEPSRLR
ASSASTAAASPLVSSIPPGPNFETPPAALSNEQQTPGVISTQFSLRPVACEKACPFRSLT
PESYAVEAQPPRRSQRIARKEAGAKRSHNVAHGEVGHLLTAPDSPVEEGGVEQTPDVQPA
HPARPAFPEKQGVARRKFKPRASKLSFQTPQADAKTPDDLDTSDGLAQADFTTPESADPN
ERWTAPGSHASTPTAVHPITRQAREEGSSDPGTPDPEPEHASEKQQAQDHQPRPVDLTSS
HALAVQILLPVYRAVAAMGHYNCHSAIDAIETLPVKHQNSGFVQVLLGRAYMELADYDAA
EQAFRSARRFEKHRLSGLEYYSTVLWHMAKITDLAYLANEVMTIDPKHAVSCLQKEADRA
CQYFQRAVQLDPTFAYAYTLLGHEFSANNDHERAQACFRQALAQNRRLYNAWFGLGMLAA
RQERLVEAEKQLILATRINPSSPILRCHLGKVLGMRGRFVLALRVLDKAYEMAPENPLVR
YTRASMLISLNRYPEALTELEKLLVDAPKESVVYFMLGKVHERVRS
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacccccgtcgccgccttggaggcggcgatccaacactcgctggactggttt
ctttacgacaatgcctgctttcttgccgaacgcctctactatgaagctgccacggacaaa
gccactctgttgcttggcaaatgctactttctatctggtcaagtgcgacgtgcctatcag
gtgctgaaaaagtgcccgctgcctgctgcgcgctatctttttgcgcgatgctgcttggac
atgcgacgcgcccacctcttcacagccgctgtgctgcccagctttcaagagggagatctg
gcactgattggcctcgacatggcaacggagccccaaaatctatctcgcttcactggccac
aacggcgcagctgaatggttgcatggttcgctgcttctgcaagccaaccgcaaacgcgaa
gccacgcgccttctgcgcaagagttgggaacaaaacggctacctcttcaccagcttcgat
gccatctgccagctggacgacaaacctgttgatgttcagcaaggctttcaagaccagacc
ctggcaacgcgacttgcattggccaatggccaacctcacatgcggccaatgacatcatca
acggccgtgccctcagttacgccgcggcacaataccgccaccttgcccgtcgccaccgct
gtcacgagcgggacaccaaaaatgctggatgagagcgcggcttccccgcccctgcaagaa
ttggacttgtcaggcatgcaatctctgccacaaactgcaaacgctaccccggctagtcgt
cggggtcgcacgcgcacggcccatgtgcgccagaccctctcttttgattcgcctgcggaa
tctcagccgtcaaccttggcctctgctgccaaagccaagcctgagccatcccgcctgaga
gcttcatcagcatccacggctgcagcatcgccactcgtgtcgtcaataccaccgggaccc
aacttcgagactccgcccgctgctctttcaaacgagcagcaaaccccaggtgtgatatct
acgcaattctctcttcgccctgtcgcctgtgagaaagcatgtccatttcgatccctaacc
cccgaatcctatgcagtggaggcccagcctcctcgtcgcagccaacgtattgcgcgaaaa
gaagcaggcgccaagcgttcacataatgtggcccatggcgaggtcgggcaccttctcacg
gcaccagactctccggttgaggaggggggcgtagagcaaacacccgacgttcagcccgct
catcctgctcgtcctgctttcccggaaaagcagggagtagcccgccgcaaattcaagcca
cgggcctccaaattgtctttccaaacgccccaggccgatgccaagaccccagatgacttg
gacacgagcgatggtttggcccaggctgacttcacgacacctgaatcagccgaccccaat
gagcgctggaccgccccaggaagccatgccagcaccccaacggccgtgcatcccataacc
cgtcaggcccgagaggaaggctcatctgacccagggacccctgatccggaacctgagcat
gcttcagagaaacagcaggcacaagatcaccagccgcgacccgtggacctgacctccagt
catgcccttgcggtgcaaattttgctgccggtgtaccgtgccgtggcggccatggggcat
tacaactgccactccgccattgatgccatcgaaacgctaccggtcaagcatcaaaactcg
ggctttgtacaagttctgcttggccgcgcgtacatggagctagccgactacgacgcggcg
gaacaggcctttcgcagcgctcggcgctttgagaagcatcgattgagtggcctcgagtac
tacagtaccgtgttgtggcacatggccaagattacagacctggcctatctggccaatgag
gtcatgaccattgacccgaaacatgccgtctcctgtcttcaaaaggaggctgatcgtgct
tgccagtactttcagcgcgctgtgcaactcgaccctacgtttgcctacgcctatacttta
ttgggccatgagttctccgccaacaacgatcacgagcgggcccaagcgtgctttcgccag
gccctggcacaaaaccgccgcctatacaacgcctggtttggcttgggcatgctggcagcc
cgacaagagcgcttggtcgaggctgagaagcaactcatcttggcaactcgcatcaatcct
tccagcccaattttgcgttgtcatcttggcaaggtgttgggcatgcgtggacgctttgtg
ctggctttgcgtgtgctcgacaaggcttatgaaatggcacccgaaaacccattggtacgc
tacactcgtgccagcatgctcatcagcctgaatcgatacccggaggcgttgaccgagctg
gagaagcttttggttgatgcacccaaagaaagcgtggtctatttcatgctgggcaaggtt
cacgaacgggtacgatcatga

DBGET integrated database retrieval system