KEGG   Monosiga brevicollis: MONBRDRAFT_27154Help
Entry
MONBRDRAFT_27154  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
mbr  Monosiga brevicollis
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MONBRDRAFT_27154
   00330 Arginine and proline metabolism
    MONBRDRAFT_27154
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    MONBRDRAFT_27154
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     MONBRDRAFT_27154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 490 aa AA seqDB search
MSFQEVCKALEELYPEAAAIHDGNNADYIPELASVNSDLFGIAVCSCNGEIWHIGDTDIP
YTFQSTIKPLLYNVAINLVGEGEVHKHIGCEPSGQRFNAFVLDEDGNPHNPLINAGAIMS
SAIIRSEVPTQVDSFKAVKTFAERCAGLVSPVQFDNSVFLSELNTASRNFALSYFMRERS
DFLKTVSIERTLELYFSACALTINCKGMATVAATYASGGTCPVTRDQVIQPVHAKDTMQI
MFSCGMYDYSGRFAFEVGIPAKSGVSGALMMSVPGKFGIGIWSPRLDKHGNTVRGLWIAK
KLVERFPQLHLFGNAVERAKVRHNRMAGYSSSKPPNGLGVDAGSPQNALERQLRSDPGVP
GAQFLIHAAATGNIETVQELVDKQNLDVNFADYDGRTALHLAMAEGHGQVARFLLDRGAD
PERKDRFGATPRSEALSTGLSDLLPPLPLSAMSKRKNSRMSNSPARDRGTLKQQSSLSSK
SDSNKSSTTA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagcttccaagaagtgtgcaaggcgctcgaagagctgtatcccgaagccgctgccatc
catgatggcaacaatgcagattacattccggaactggcaagcgtgaactcagaccttttt
ggcattgctgtttgctcgtgcaacggtgaaatttggcacattggagacacagacatcccc
tacacatttcaatccaccatcaagccccttctctacaacgtggccatcaatctggtcggc
gagggtgaggtccacaaacacattggctgtgagccctctggccagcgatttaacgcattc
gtgctggatgaggatggcaacccacacaatcccttgatcaatgctggcgccatcatgtca
tcagccattattcggtcagaagtcccaacacaagtggacagcttcaaagccgtcaagaca
tttgctgagcgctgcgcgggcctcgtgtctccggtccaatttgacaacagcgttttcctc
tcagagctcaacacggcctcccgcaactttgccctgagctactttatgcgcgagcgcagc
gactttctcaagaccgtctcgattgagcggactctggaactctacttttccgcatgtgcc
ctcaccatcaactgcaaaggtatggccacggtggctgccacatatgcctctggtggcacc
tgccctgtgactcgtgaccaggtgattcaaccagtccatgccaaggacacgatgcaaatt
atgttcagctgtggcatgtacgattattcggggcgctttgccttcgaagtcggcattccc
gccaagagcggcgtgtcgggagcgctgatgatgtcagtgccgggcaagtttggcattggc
atctggtcaccgcgcttggacaagcacggtaataccgttcgtggattgtggattgccaag
aagctcgtggagcgttttcctcagctgcatctgttcggcaacgccgttgaacgggccaag
gtgcgccacaaccgcatggctggttattctagtagcaaacctcccaatggtctgggcgtg
gatgctggctctccacagaatgccttggaaaggcaactgcgcagcgacccgggcgttcct
ggtgcacagttcttgatccacgctgctgccactggcaacattgaaacggtccaagaattg
gtggacaagcagaacctcgatgtcaactttgctgattatgacggccgcacggctcttcac
ctggccatggcggaaggacacggccaagtggctcgcttcctcctggaccgtggtgcggat
cccgaacgcaaggatcgtttcggtgccaccccacgctcagaagctctcagcactggattg
tccgacctgctgccacctttgcctttgagtgctatgagcaagcgcaaaaactcgcgaatg
tccaacagcccggctcgggaccgcgggacgctcaaacaacagtcctcgctcagctccaaa
tcagactcgaacaagtcgagcaccacggcgtaa

DBGET integrated database retrieval system