KEGG   Monosiga brevicollis: MONBRDRAFT_27243Help
Entry
MONBRDRAFT_27243  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
mbr  Monosiga brevicollis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MONBRDRAFT_27243
Enzymes [BR:mbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MONBRDRAFT_27243
Exosome [BR:mbr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MONBRDRAFT_27243
  Exosomal proteins of colorectal cancer cells
   MONBRDRAFT_27243
  Exosomal proteins of bladder cancer cells
   MONBRDRAFT_27243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 466 aa AA seqDB search
MKAVLVLGLALLVALAAAEDVITLTESNFESTLKQHDLAVVEFFAPWCGHCKRLAPEYEK
AAGILKKSDTPVALAAVDATEHGSLASRFGVTGYPTLKIFRKGELSADYQGPRDAAGIVK
YMEKQAGPSSKRKCFLIDNASMFSSLDSGMARAFLKTADAERENFRFAHTTQSKALGQYG
KDVVVVFRPQKLSNKFEEGHVVYSGKAKNTLIKEFIMDAITSPGGIMTPDHRPFFFASKP
LLVVYYDLDVKMNPSRAKYIRNRVLKVAQDVTSDLTIAVANKADFAQDVQQLGLDEFSVA
AGIWGEGSTKYRLDEEWSMDAMRQFIADFEADKLESHVKSEANPEPDGDVVVATGKTIDE
ILNAPGKDVLIEAYAPWCGHCKKLAPVFSELATKFKDEDSVTVAKIDATANDLPASLPVS
GYPSIFWVPADSKKPEKYSGGRELKDFTQFIKSRASGLSKKVKDEL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggtgttggtgctgggcttggccctgctggtggccctggcggctgctgaagat
gtgattacgctcacggagagcaactttgagtcgaccctcaaacagcatgacctggctgtc
gttgaattctttgccccttggtgcggtcactgcaagcgtctggctcccgagtatgagaag
gcggctggtatcttgaaaaagtcggacacgccagtagctctggctgcggttgatgccacc
gagcacggatcgctggcttcccgttttggcgtcactggctaccccactctcaagatcttc
cgcaagggtgaactcagtgccgactaccaaggccctcgcgatgccgctggcattgtcaag
tacatggagaagcaagctggtccctccagcaagcgtaagtgcttcctcatcgacaacgcc
agcatgttctctagcctggacagtggcatggcacgcgccttcctcaagacggcagatgcg
gagcgcgaaaacttccgcttcgcgcacaccacccaaagcaaggctttgggacagtacggc
aaggatgttgtggttgtcttccgcccccagaagctgagcaacaagtttgaagagggtcac
gtcgtgtacagcggcaaggccaaaaacacgctgatcaaggagtttatcatggatgccatc
acttctcctggtggcatcatgaccccagatcaccgccccttctttttcgcctccaagccc
cttttggtggtgtactatgatctcgatgtgaagatgaacccatctcgcgccaagtacatt
cgcaaccgcgttctcaaggttgcacaggacgtgacttcagatttgaccattgccgtggcc
aacaaggccgactttgctcaggacgtgcaacagcttggcctggatgagtttagcgtggcc
gccggtatctggggcgagggctcgaccaagtatcgtttggatgaggagtggagcatggat
gccatgcgccagttcattgctgattttgaagccgataagctcgagtcacacgtcaagtca
gaagccaaccccgaacccgatggtgatgtggtggtggccactggcaagaccattgatgag
attttgaacgcacctggcaaggacgttctgattgaggcttatgcgccctggtgtggccac
tgcaagaagcttgctcccgtctttagcgagcttgccaccaagtttaaggatgaagacagc
gtcaccgttgccaaaatcgatgccacggccaacgaccttccggccagcctgcccgtgtca
ggctatccttcaatcttctgggtgcccgctgacagcaagaagcccgaaaagtactcgggt
ggtcgcgaactcaaggactttacccaattcatcaagagccgtgcttcgggcctcagcaag
aaggtcaaggacgagctctaa

DBGET integrated database retrieval system