KEGG   Monosiga brevicollis: MONBRDRAFT_27243Help
Entry
MONBRDRAFT_27243  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
mbr  Monosiga brevicollis
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:mbr04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 466 aa AA seqDB search
MKAVLVLGLALLVALAAAEDVITLTESNFESTLKQHDLAVVEFFAPWCGHCKRLAPEYEK
AAGILKKSDTPVALAAVDATEHGSLASRFGVTGYPTLKIFRKGELSADYQGPRDAAGIVK
YMEKQAGPSSKRKCFLIDNASMFSSLDSGMARAFLKTADAERENFRFAHTTQSKALGQYG
KDVVVVFRPQKLSNKFEEGHVVYSGKAKNTLIKEFIMDAITSPGGIMTPDHRPFFFASKP
LLVVYYDLDVKMNPSRAKYIRNRVLKVAQDVTSDLTIAVANKADFAQDVQQLGLDEFSVA
AGIWGEGSTKYRLDEEWSMDAMRQFIADFEADKLESHVKSEANPEPDGDVVVATGKTIDE
ILNAPGKDVLIEAYAPWCGHCKKLAPVFSELATKFKDEDSVTVAKIDATANDLPASLPVS
GYPSIFWVPADSKKPEKYSGGRELKDFTQFIKSRASGLSKKVKDEL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggtgttggtgctgggcttggccctgctggtggccctggcggctgctgaagat
gtgattacgctcacggagagcaactttgagtcgaccctcaaacagcatgacctggctgtc
gttgaattctttgccccttggtgcggtcactgcaagcgtctggctcccgagtatgagaag
gcggctggtatcttgaaaaagtcggacacgccagtagctctggctgcggttgatgccacc
gagcacggatcgctggcttcccgttttggcgtcactggctaccccactctcaagatcttc
cgcaagggtgaactcagtgccgactaccaaggccctcgcgatgccgctggcattgtcaag
tacatggagaagcaagctggtccctccagcaagcgtaagtgcttcctcatcgacaacgcc
agcatgttctctagcctggacagtggcatggcacgcgccttcctcaagacggcagatgcg
gagcgcgaaaacttccgcttcgcgcacaccacccaaagcaaggctttgggacagtacggc
aaggatgttgtggttgtcttccgcccccagaagctgagcaacaagtttgaagagggtcac
gtcgtgtacagcggcaaggccaaaaacacgctgatcaaggagtttatcatggatgccatc
acttctcctggtggcatcatgaccccagatcaccgccccttctttttcgcctccaagccc
cttttggtggtgtactatgatctcgatgtgaagatgaacccatctcgcgccaagtacatt
cgcaaccgcgttctcaaggttgcacaggacgtgacttcagatttgaccattgccgtggcc
aacaaggccgactttgctcaggacgtgcaacagcttggcctggatgagtttagcgtggcc
gccggtatctggggcgagggctcgaccaagtatcgtttggatgaggagtggagcatggat
gccatgcgccagttcattgctgattttgaagccgataagctcgagtcacacgtcaagtca
gaagccaaccccgaacccgatggtgatgtggtggtggccactggcaagaccattgatgag
attttgaacgcacctggcaaggacgttctgattgaggcttatgcgccctggtgtggccac
tgcaagaagcttgctcccgtctttagcgagcttgccaccaagtttaaggatgaagacagc
gtcaccgttgccaaaatcgatgccacggccaacgaccttccggccagcctgcccgtgtca
ggctatccttcaatcttctgggtgcccgctgacagcaagaagcccgaaaagtactcgggt
ggtcgcgaactcaaggactttacccaattcatcaagagccgtgcttcgggcctcagcaag
aaggtcaaggacgagctctaa

DBGET integrated database retrieval system