KEGG   Monosiga brevicollis: MONBRDRAFT_27441Help
Entry
MONBRDRAFT_27441  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
mbr  Monosiga brevicollis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1846 aa AA seqDB search
MGGQSAAGVWCGRGKSKQFQKDREKGSGGGDGEGDADFKAPREGCAGLGGVRTATLVQAG
LWMYLSSGEMERKRIAQHNHQAAHRQYDAPHDKRAKDRCSKCRERWYCSAACQIKDWKLG
HRFNCNKVVQHSPIEQRLPRPAMYVCLDPPTTLCHDMSSIGQNDVVAQHWAAGTQEQNGL
VNIKNTCYINSVVQVLASLPAFLEAIYAMYAKSSKGIDEMPLTVALLSTLAGIVDRRDLE
NVPRLFNLGESGSPVQPAMVNALAPIPLLQAVMTKQSTMVFGQQEDAHELFQMLMHAIID
ELAPDGLPKAIQETTSVHQLFRSIITSQLTCPSCGYSSSSFESHLDLQLEIEEYTDTLEE
MLEAFTCPEQLDKSNKYRCAGCDQLVRAHKQLSLYEAPNVLAIQLKRFRAGAHGRIDRFI
QYPHQLNLKNYMTPGHHDDGKMEYELCGIIIHLTVGNLTTFGHYVSVVKQGSGDWLLCND
TYTSVLAKEDIEKTTPYMLFYKRREFRPLPTDVDPAAAQEKEKGKCKSGCGFFGAAEYGG
HCSKCFKALSPVEQDACKQAAVVDAAQPNEPAAVSSRKVGRNEKCPCNSGRKYKACHGKQ
FYVESNPNEAQLAPAAPTHRNKDKQPKSKTLTLGLILCLNIGVTPPDVVRTHPCAKLEAW
IDPEEKPKAIELISQRLTSQYLRWQPKAKFRQAPDPTLDEVKRLCLALRRRAKDECVLLH
FNGHGVPRPTANGELWLFNKDYTQYLPASIYDIQSWVGAPTIFVYDCSGAGILVEKFNYF
AQRRKKDIHRQPSVANAEQMQDCLQLAACRADESLPTSPDYPADLFTACLTTPVEMALRW
VFTTKQQRLLPHVTLDMLDDLPGQLSDRTTMRGSLNWIFTAVTDTIAWEVLPISVFQRIF
RNDLLAAALFRNFLLAVRIMRDVNCTPVSEPPLPQTHDHPMWEAWDCAVDFCLAQLPAVV
HGEQEFQEAPFFNDQMTAFSVWLDLVESSDAEVPKAPEQLPILLQVLLSQPHRLRALELL
NRFMSLAPWAVEQTLAVGIFPYVFKLLSSLAVDLQEVLVSIWARILVVDRSRKQDLLKPP
GSVVRRSSGRGSDKAFMYFVNILKDAAQPPALLAAAAFILVIFLEDHPEAQDICLRADLI
AVAAQLLDPAVTTSSTLRKWVALLLGKLFNGHEMAQREARSKVLVVLRLTELLHDSSPQT
RAATVYALGHLICGGEDDVDMNVSTIGSALISIQDDGSHVVRMELAASLSPLVVLYTAQL
IDAASALKRADSLAMRLPSDEPFILVLKSLLLLATDPFPAVAETACTLLAHLGIRATRKP
MKLREKPMPSRPRDIASSPATPTLPGSPGFGAMSLDGLTASSLGPHSPMSLASSYVSLLP
SARAQMHQPVRDDLRDLVELLATTAQQLEEQEQGMDRDPREALSSICLQLRRITEAAPSI
VRQLQGLADAGQPGTNVGLRLAHTNFARTAIDSFCLWQHNKDSDAYAKAEDLDWRRERSH
DAQERAGALVEAPERLVKPVDAMFHKLCTESFDMLAFHPHDTLVAAANKESGNVHVYDMT
NAQPPVMFSSKATKHGAISSIKVINPDLDSLLLTGYADGTVRLWRDWSTPNPGLHSAWRA
VSKMRESSDGVGAGLVLEWDQSSGQLIATGDINYLQIWDARSEMRTRKLSSNIDSCITSL
CIDRDDPQRLLAGYGNGLIRLFDLRHSDDRAVVQQYSVHQDYIVSVHSAKESERMMSGSR
SGQILWWDYRYPGQPIRTMTAHRTRGDVVLQCLDTHDYAPIFATANSLQQFKIFNKQGQL
LHHHKHYTNFLGEAIGPITALKFHPYEAKLGVSSLEKLLTVYSAPC
NT seq 5541 nt NT seq  +upstreamnt  +downstreamnt
atggggggccaaagtgcagcaggtgtgtggtgtggcaggggaaagagcaagcaatttcag
aaagacagagaaaaaggtagtggtggtggtgatggcgaaggcgatgctgacttcaaggcc
ccccgggagggctgtgccggcttgggtggggttcgaacagccactttggtgcaggcgggc
ctgtggatgtacctgagctctggagagatggagcgaaaacgtatcgcacagcacaaccac
caagctgcccaccgccaatacgatgcgccacacgacaagcgagcaaaggatcggtgtagc
aagtgtcgtgagcgctggtattgctccgcagcatgtcaaatcaaggattggaagctggga
catcgctttaattgcaacaaagttgtgcaacacagccccatcgagcagcgtttgcctcgg
cctgccatgtatgtctgcctggaccccccaactaccctttgccatgacatgagctcgatt
ggccagaacgacgtggtcgcccagcattgggcagctggtacccaggagcagaatggcctt
gtcaacattaagaacacgtgctatatcaatagcgtcgtgcaagtcctagcctcacttcca
gcctttctcgaggccatttatgcgatgtatgccaaaagctcaaagggcatcgacgagatg
cccctgactgtggcacttttgtctacgctggcgggcattgtggaccgccgtgatctggag
aacgtgccgcgtctctttaatctcggcgaaagcggatctcccgtgcaacccgcgatggtt
aatgccctcgcccccatcccccttcttcaggccgtcatgaccaagcagtctaccatggtc
tttggtcaacaagaggatgcacacgagctctttcaaatgctgatgcacgccatcatcgac
gaacttgctcccgacggcttgcccaaggcgattcaggaaacaaccagtgtccatcaactc
tttcgcagcatcatcacgagtcagctcacgtgcccatcctgcggctacagcagcagcagc
tttgagtcccaccttgaccttcagcttgaaattgaagagtacactgacacgctcgaggag
atgcttgaagccttcacttgtcctgagcagctggacaagagcaacaagtatcgctgtgct
ggctgtgaccagcttgtccgtgcacacaagcagttgtctctgtacgaggctcccaacgtt
ttggccattcagctcaagcgcttccgtgccggtgctcacggccgcatcgacagatttatt
cagtacccacatcaactcaacttgaagaactacatgacacctggtcaccacgacgacggc
aaaatggaatatgagctgtgtggaatcatcatccaccttaccgtcgggaatttgacaacc
tttggtcattatgtcagcgtcgtcaagcaaggctcaggcgattggttgctttgcaatgac
acttacacgagtgttctggccaaggaggatattgagaaaaccaccccgtacatgctcttt
tacaagcggcgagagtttcgtcccttgcccaccgatgtggatccagccgctgcacaggag
aaggaaaaggggaaatgcaagagcggttgcggtttcttcggcgcagccgaatacggtggc
cactgctcaaagtgtttcaaggcgctgtcgcccgttgagcaagatgcatgcaagcaagcg
gcagtagtggatgccgcacaacccaacgagccagctgcagtctcaagccgcaaagttggt
cgcaatgagaaatgcccttgcaacagtggacgcaagtataaggcctgtcacggcaagcag
ttttatgtggaatccaatcccaacgaagcccaattggctcccgcggcgcccacccaccgc
aacaaggacaagcaaccaaaaagcaagaccttgaccctcgggctcattctttgcctaaac
attggcgtgaccccaccagacgtcgtgcgcactcacccctgtgccaaacttgaggcctgg
atcgatcccgaggagaaacccaaggccatcgagctcatctcgcagcgcttgacctcgcaa
taccttcgctggcagcccaaggccaaatttcgccaagcgcccgaccccaccctcgatgaa
gtgaaacggctatgcttggctttgcgtcgacgcgccaaggatgaatgcgttctcttgcat
tttaatggccatggcgttccccgcccgacggccaacggcgagctctggctattcaacaag
gattacacccagtaccttccggcctccatttatgacattcagtcgtgggtgggtgcccca
accatctttgtctacgactgttccggtgccggcattttggttgaaaagttcaactacttt
gcccagcgccgaaaaaaggacattcaccgccagcccagcgtggccaatgctgaacagatg
caagactgcttgcagctggccgcgtgtcgtgccgatgaaagcctgcccacgagtccagac
tatcctgcggatctctttacagcttgcttaaccacgcccgtggagatggcgctgcgctgg
gtgtttaccaccaagcagcaacgccttttgcctcatgtgaccctcgacatgctggatgat
ttgcctggtcagctatcggatcgcaccaccatgcgtgggtctctcaactggatcttcaca
gccgtgaccgacaccattgcatgggaagtcctccctattagcgtttttcagcgcatcttt
cgcaacgacttgcttgccgcagccctctttcgcaactttctgctggccgttcgcatcatg
cgcgatgtaaactgcactcccgtctccgagcccccactgccgcaaacgcatgatcatccc
atgtgggaggcttgggattgtgctgtcgacttttgcctggcacagctgcctgcagttgtg
catggcgagcaggagtttcaggaggcaccctttttcaacgaccaaatgactgcctttagc
gtctggctggatttggtcgagtccagtgatgccgaggtccccaaagcgcccgaacaactg
ccaattctgctgcaggtccttctgagccaacctcatcggctgcgcgccttggagctgttg
aatcgtttcatgagcttggcgccatgggcagtggagcagacgctggccgttggcatcttt
ccctacgtgttcaagctcctgagctcacttgctgtggacttgcaagaggtccttgtgagc
atctgggctcgcatcctggtcgttgatcgatcgcgcaagcaagacctccttaagccaccc
ggttccgttgtgcgccgttcatccggcagaggcagtgataaggcgtttatgtactttgtc
aacattctcaaggatgcagcgcagcccccagccttgctggcggccgccgcctttattctt
gtcattttcctggaggatcatcctgaagcacaagacatttgcctgcgtgcagatttgatt
gccgtggcagcacagcttttggatcctgctgtaactacgtcttctaccttgcgcaaatgg
gttgcacttctcctgggcaaactgttcaatggccatgagatggctcagcgtgaagcacga
tccaaggtgctcgttgttctacgtttgacagagttgctccacgattcttcgcctcaaacc
cgcgccgccaccgtctatgccctgggtcacctcatttgcggcggtgaggacgacgtcgac
atgaacgtttccacaattgggtcagccttgattagcatccaagacgatggcagtcatgtg
gtgcgcatggaactggccgcctcgctgtcaccgctggtggtattgtacacagctcagctc
attgatgcggcctcagccttgaagcgagccgactcactggccatgcgcctcccatcggac
gaaccgtttatcctcgtgctgaaaagcctgcttctcttggctactgacccttttccagcc
gtggcagagacggcgtgcacgctcttggcgcatctgggcattcgcgccacccgcaagcct
atgaagctccgagaaaagcccatgccctcacgtcctcgcgacattgcgagctccccagcc
acgccgacgcttcctggaagccctgggtttggagccatgagtttggacggcttaactgca
tcctcgttggggccccactcgccaatgtctctggcatcttcctacgtcagcctgttgccc
tcggcccgcgctcaaatgcaccagcccgttcgtgacgacctgcgtgacctggtcgagctc
ctcgccacaaccgcacagcagctggaagaacaggaacagggcatggaccgcgatccccgt
gaggctctgtcttcaatctgccttcaattacgccgcattaccgaggcagctccatcaatt
gtgcgacagctgcagggattggccgatgcggggcagcctggaaccaatgtggggcttcgc
ctagcacacaccaattttgcgcgcacggcgatcgattcgttctgtttgtggcagcacaac
aaggacagcgacgcttatgccaaggctgaagacttggactggcgccgtgagcgttcacac
gatgcccaggagcgggctggagcccttgttgaagcgcctgagcggcttgtcaagcccgtg
gatgcaatgtttcacaagttgtgcactgagtcctttgacatgctggcgtttcacccccat
gacacgttggtggcggcggcgaataaggaaagtggcaacgtgcacgtgtatgacatgacc
aatgcccaaccaccggtcatgttttcctccaaagcaaccaagcacggcgccatctcctcc
atcaaggtcatcaacccagacctggactctctgctgctaacgggctacgctgacggcacc
gtgcgcctctggcgggattggtcaacgcccaatccgggcctccactcggcctggcgagct
gtgtctaagatgcgtgagtccagtgacggcgtgggggctggcctagtgctggaatgggat
caaagcagcggacagctgatcgccacgggggacattaactatcttcagatttgggatgcg
cgcagtgaaatgcgcacgcgcaagctgtctagcaacattgacagctgcattaccagcttg
tgcattgatcgggatgatccacagcgactgctggctgggtacggcaatggtctgattcgc
ctctttgatctgaggcacagcgacgaccgcgccgtcgttcagcagtacagcgtacaccaa
gactacattgtgagcgtgcactcggccaaagagagcgagcgcatgatgtctgggtctcga
agtggtcagatcctctggtgggactaccgttacccaggccagcctatccgcacgatgacg
gcacatcggacgcgcggagatgtggtcttgcagtgccttgacacgcacgattacgcaccc
attttcgctacggccaactcgctgcaacagttcaagatcttcaacaagcaaggtcaattg
ctccatcaccacaagcactacacaaactttctcggcgaggccatcggtcccatcacggca
ctcaagttccacccttatgaggccaaattgggcgtgtcttccctggaaaagcttttgacc
gtatactcggcgccatgctaa

DBGET integrated database retrieval system