KEGG   Monosiga brevicollis: MONBRDRAFT_27550Help
Entry
MONBRDRAFT_27550  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mbr  Monosiga brevicollis
Pathway
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    MONBRDRAFT_27550
Enzymes [BR:mbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     MONBRDRAFT_27550
Protein kinases [BR:mbr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   MONBRDRAFT_27550
Chromosome [BR:mbr03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     MONBRDRAFT_27550
Exosome [BR:mbr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MONBRDRAFT_27550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 339 aa AA seqDB search
MFNVGERYTNLNFIGEGAYGTVASAHDQVTGDMVAIKLITPFEHQTYCQRTLREIKILSA
FRHENIIDIRDMICAPRIEDMTDVYIVQGLMETDLFKLLRSQRLSGDHICYFTYQILRGL
KYIHSANVLHRDLKPSNLLLNSCCDLRICDFGLARIADPNHNHQGVLTEYVATRWYRAPE
IMLNSKAYDKAIDVWSTGCILAEMLGSRPLFPGRHYLDQLNRILSVVGTPSESDLACIRN
EKARRYVQSQPFSDKVQFSQLFPGADPRALDLLDRMLTFNPDRRITVEEALAHPFLSQYY
DPTDEPVAEKPFRFEMELDDLPKEELKRMIFDEVQKFQL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttcaacgtcggcgaacgctataccaacctcaactttatcggcgaaggtgcttatggc
accgttgcctcggctcatgatcaagtcaccggtgacatggtcgccattaagctcatcacc
ccctttgagcaccagacttactgccagcgcacccttcgtgagatcaaaatcctatcagcg
tttcgtcacgaaaacattattgacattcgcgacatgatctgcgcgccacgcatcgaagac
atgaccgatgtgtacattgttcagggcctaatggagacggaccttttcaagctcctccgc
tcccagcgtctcagcggtgatcacatttgctactttacgtaccaaattcttcgtggtctc
aagtacattcacagtgccaacgtgctgcatcgtgatctcaagcccagcaacctcctgctc
aactcgtgctgtgatctccgcatttgcgactttggcctcgcccgcattgccgatcccaat
cacaaccatcaaggcgtcctcaccgagtacgtcgccacccggtggtatcgtgctccggaa
atcatgctcaattcaaaggcgtatgacaaggccattgacgtttggagcacgggctgcatt
ctggccgagatgctcggttcccgccccctttttcctggtcgccactatcttgaccaactg
aaccgcattctcagcgttgtgggtaccccctcagagagcgacctggcctgcatccgcaac
gaaaaggcccgtcgctacgtacagtcgcaacctttctctgacaaggtgcaatttagccag
ctgttccccggcgccgaccctcgcgccctggacctgcttgatcgcatgctcaccttcaat
ccagaccgccgcatcaccgtcgaggaggccctggcccatccattcctcagccagtactac
gaccccacggacgagcccgtggcagaaaagcccttccgctttgagatggagctcgatgac
ttgcccaaggaggaactcaagcgtatgatctttgatgaagtgcaaaagtttcagctctaa

DBGET integrated database retrieval system