KEGG   Monosiga brevicollis: MONBRDRAFT_27754Help
Entry
MONBRDRAFT_27754  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
mbr  Monosiga brevicollis
Brite
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MONBRDRAFT_27754
Peptidases [BR:mbr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MONBRDRAFT_27754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 701 aa AA seqDB search
MADAENIAITKAEAALGHSETATKRNPVVLEEDGEPPHKRAAQGSGDDVSSQRKPPRSKT
DVKFPLYPSSSSFKPNTIAQPPAKETLPRAGPSNSSSSAVAASPSGTPSHSFNSLSIGRT
PIRLSPSVEDARYAALCGLDNMGNTCYLNSVLQCLRFLPLMSECLNYTSLLDKVPFSVDN
HPLLLRWQLLMEDMADAEKSHRLRADQLFATRTISLAPTSFKHELGVANALFDSFMQQDA
QECLRFLLNHLQEAQEAALQPASVPSSADGQQAEAPTALRRASLPLLPSSSLGRPVELDH
EPELTDASASLSFVDQADLDMLESGPFGDSQDEYHNNWLQVQKMETENAPTPSDSGSGSR
SNSLPDIDLQASALAPEHEYGAATASTVVIDDDEDANEDDDEEDEGNNGDEAGGDASSNG
VVDNDGSDTSRSDAADKTDFAIRISSAESTGRDEGSISQQRELSSSVENAILVADASGSL
DDNIVQVDGPMTAPIAHQASSPPDSSAEPKIPFTGSLFEGHMLYTTRCLTCDARSDRREA
FHDISIPVPSEPQTLKACLAQLFGKRERMVGADKIFCEQCQAKQEATREMSVADLPPVLT
LHLNRSDHLGAKASRCLTLPPILQQQNNPVTAIDYVAPSFIGGKQPTLDIILPWFGVQSC
SMRRKAGLVRHCCVIKQRSKQQLRWRTGLGLPCPEGLLPKS
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcagagaacatcgcaatcaccaaggccgaggccgctttggggcacagtgaa
accgcaacaaagcggaatcccgtcgtcttggaggaagatggagagccaccccacaagcgt
gccgcccaaggctcgggcgatgatgtttcaagtcagcgcaagccaccacgatccaaaacg
gacgtcaaattccctctttacccctcttcttcgagctttaaaccaaacaccattgcccag
cctcccgccaaggaaaccttgccccgcgcaggcccctcaaatagtagtagcagtgccgta
gcagcttcgcctagtggcacaccgagtcactccttcaactccctgtcaattggccgcacc
ccaattcgactatcgccatcagttgaggacgcgcgttacgcagctctttgcgggcttgat
aacatgggcaacacttgctatctcaattcagtccttcaatgtctaaggtttttacctctc
atgagcgaatgcctcaattacacgtcgctgctcgacaaggtcccattttcggtcgacaac
cacccgcttcttctcaggtggcagctgctcatggaggatatggctgatgccgagaaaagt
caccgcttgcgagcggatcagctctttgccacacgcacaatttctttggcaccaacctcc
ttcaagcacgaactcggcgtggccaatgcgctctttgactctttcatgcaacaagacgct
caagagtgcttgcggtttttattaaaccacttgcaagaagctcaagaggcagcgcttcag
cctgcctccgtgcccagctctgcggatggacagcaagcagaagctccaactgctctgcgc
cgcgccagcctgcctctccttccatcgtccagtttaggccgtcccgtcgagttggatcat
gaaccagaactgacggatgcatctgcatctctgtcgttcgtggaccaggcagaccttgac
atgctagaatctgggccatttggcgattctcaggatgaatatcacaataattggcttcaa
gtgcagaagatggagacagaaaacgctccaacgccttctgattcaggttccgggtcgaga
tcaaacagtctcccagatattgatttacaggcaagcgccctggcaccggaacacgagtat
ggcgctgcaaccgccagtactgtggtgattgatgacgatgaagatgccaacgaagatgac
gacgaggaagacgaaggtaacaacggagatgaagctggcggcgatgcaagtagcaatggg
gtcgttgacaatgacggtagcgacacttcaagaagcgatgcagcagacaagacagatttt
gcgatccgcatctcaagtgcagagagcacgggccgggatgaaggctcaatatctcagcaa
cgagagctttcgtcaagcgttgaaaatgccatactcgtggccgatgccagtggcagcttg
gacgacaacattgttcaagtggatggaccgatgacggcaccaattgctcaccaagcgagc
agcccgccagactcgagcgccgaacccaagatacccttcactggcagcctctttgaaggc
cacatgttgtacaccacccgttgccttacctgtgacgcccgctcggatcgacgcgaggct
tttcatgacatttcaattccggtcccctctgagccgcaaacactcaaggcttgtttggcg
cagctgtttggaaagcgggagcgcatggtgggggcggacaagatcttttgcgagcaatgc
caagccaaacaagaggcaacgcgagagatgagcgtggccgacttgccccctgtgctcacc
cttcacctcaatcgctccgatcaccttggtgccaaggcaagtcgttgtctcacgctgccc
cccattttgcagcaacagaacaaccccgtcaccgctatcgattatgtagcgccatctttc
atcgggggcaaacagcctactctggacattattttgccatggttcggcgtgcagagctgc
agcatgcgacgcaaggctggtcttgtgaggcactgctgcgtcatcaagcagcgcagcaag
cagcagctgagatggaggacaggactggggttgccctgtcccgaggggcttctgcccaaa
agctga

DBGET integrated database retrieval system