KEGG   Monosiga brevicollis: MONBRDRAFT_27890Help
Entry
MONBRDRAFT_27890  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mbr  Monosiga brevicollis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mbr00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mbr00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 143 aa AA seqDB search
MASTASTNPDPKEAKSIFEFAAEDINGKPFSFQTLEGKVVMIVNTAGQCGLAQRNFTEMV
ELHDKYKDQGFEIVAFPSNSFNQIAVNGSDTHPLYTYLKGASPGWLTNSLKWNFTKFLCD
RTGVPRKRFGPQEAPSTMATDIE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcacggcatccaccaacccggatccaaaggaggccaagtccatctttgagttt
gcggcggaggatatcaatggcaagcctttttcatttcaaacgctcgagggcaaggtggtg
atgattgtaaacacagccggtcaatgtgggttggcccaacgaaattttacggaaatggtg
gagctgcacgacaagtacaaggaccagggctttgaaattgttgcctttccctccaactcc
tttaatcagattgctgtcaacggctcggacacgcatcccctttacacgtatctcaagggt
gcttcgccgggctggttgaccaatagcctgaaatggaatttcacaaagtttttgtgtgat
cgcactggcgtgccgcgcaaacgattcgggccacaggaggccccctccaccatggcgaca
gacattgagtag

DBGET integrated database retrieval system