KEGG   Monosiga brevicollis: MONBRDRAFT_27890Help
Entry
MONBRDRAFT_27890  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mbr  Monosiga brevicollis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MONBRDRAFT_27890
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MONBRDRAFT_27890
Enzymes [BR:mbr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MONBRDRAFT_27890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 143 aa AA seqDB search
MASTASTNPDPKEAKSIFEFAAEDINGKPFSFQTLEGKVVMIVNTAGQCGLAQRNFTEMV
ELHDKYKDQGFEIVAFPSNSFNQIAVNGSDTHPLYTYLKGASPGWLTNSLKWNFTKFLCD
RTGVPRKRFGPQEAPSTMATDIE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcacggcatccaccaacccggatccaaaggaggccaagtccatctttgagttt
gcggcggaggatatcaatggcaagcctttttcatttcaaacgctcgagggcaaggtggtg
atgattgtaaacacagccggtcaatgtgggttggcccaacgaaattttacggaaatggtg
gagctgcacgacaagtacaaggaccagggctttgaaattgttgcctttccctccaactcc
tttaatcagattgctgtcaacggctcggacacgcatcccctttacacgtatctcaagggt
gcttcgccgggctggttgaccaatagcctgaaatggaatttcacaaagtttttgtgtgat
cgcactggcgtgccgcgcaaacgattcgggccacaggaggccccctccaccatggcgaca
gacattgagtag

DBGET integrated database retrieval system