KEGG   Monosiga brevicollis: MONBRDRAFT_28483Help
Entry
MONBRDRAFT_28483  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
mbr  Monosiga brevicollis
Pathway
mbr01100  Metabolic pathways
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Haem_bd
Motif
Other DBs
NCBI-GeneID: 5894137
NCBI-ProteinID: XP_001748907
JGI: 28483
UniProt: A9V8A8
AA seq 104 aa AA seqDB search
MGDVEKGKKIFQRACAQCHTVEKGAPHKQGPNLNGLFGRKTGQAEGFAYSEANINKGITW
GEDTLFEYLLNPKKYIPGTKMVFAGLKKKSDRENLIAYLKDSCA
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgtcgaaaagggcaagaagatcttccagcgcgcttgcgctcagtgccacacc
gtcgagaagggtgctccccacaagcagggccccaatctcaacggtctctttggccgcaag
actggccaggccgagggctttgcttactccgaggccaacattaacaagggcatcacctgg
ggcgaggacactctcttcgagtacctcctgaaccccaagaagtacattcccggcaccaag
atggtctttgctggtctcaagaagaagtcggaccgcgagaacctcattgcctacctcaag
gactcttgcgcataa

DBGET integrated database retrieval system