KEGG   Monosiga brevicollis: MONBRDRAFT_28483Help
Entry
MONBRDRAFT_28483  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
mbr  Monosiga brevicollis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MONBRDRAFT_28483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 104 aa AA seqDB search
MGDVEKGKKIFQRACAQCHTVEKGAPHKQGPNLNGLFGRKTGQAEGFAYSEANINKGITW
GEDTLFEYLLNPKKYIPGTKMVFAGLKKKSDRENLIAYLKDSCA
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgtcgaaaagggcaagaagatcttccagcgcgcttgcgctcagtgccacacc
gtcgagaagggtgctccccacaagcagggccccaatctcaacggtctctttggccgcaag
actggccaggccgagggctttgcttactccgaggccaacattaacaagggcatcacctgg
ggcgaggacactctcttcgagtacctcctgaaccccaagaagtacattcccggcaccaag
atggtctttgctggtctcaagaagaagtcggaccgcgagaacctcattgcctacctcaag
gactcttgcgcataa

DBGET integrated database retrieval system