KEGG   Monosiga brevicollis: MONBRDRAFT_29079Help
Entry
MONBRDRAFT_29079  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mbr  Monosiga brevicollis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mbr00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mbr00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 205 aa AA seqDB search
MRVALVVAATKAGGIGHQGQLPWHLKADMQHFRDITTKTEQPAAINAVIMGRKTFESIPD
KFRPLHGRLNVVLSTQKPATLNYPPGVLVASSLQEAFEFLDISPEVIETAYIIGGASVYN
EALAKPEYSHYIFMTKVHKDVLCDTVMDMKHLDAYEHDPNFPVQPSLIGVDSGLTTHINL
LTHADKQEHKEDDVEYTISLLRRKQ
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtggcactcgtcgtcgcggccaccaaggctggtggcattggtcatcagggccag
ctgccatggcatctcaaggcggacatgcaacactttcgggacattaccaccaagactgag
cagccagcggccatcaatgcggtcatcatgggccgtaagacattcgagtccatcccggac
aagttccgccccctgcatggtcgcttgaacgtggtgctaagcacccagaagccagcaacg
ctcaactatccgccgggcgtgctcgtggccagttcgctgcaagaagcctttgagtttctg
gacatcagccccgaggtgatcgagactgcctacatcatcggtggcgccagcgtgtacaat
gaggcgctggcaaagcctgagtattcgcactacattttcatgaccaaagtgcacaaggac
gtgctctgcgacacggtgatggacatgaagcatctggacgcttatgagcatgaccccaac
tttccggtccagccatccttgatcggtgttgattcgggactaaccacgcatatcaacctt
ttgacgcacgctgataaacaggagcacaaagaagacgacgtcgagtacaccatctccctt
cttcgtcgcaaacagtaa

DBGET integrated database retrieval system