KEGG   Monosiga brevicollis: MONBRDRAFT_29079Help
Entry
MONBRDRAFT_29079  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mbr  Monosiga brevicollis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MONBRDRAFT_29079
   00670 One carbon pool by folate
    MONBRDRAFT_29079
Enzymes [BR:mbr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MONBRDRAFT_29079
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 205 aa AA seqDB search
MRVALVVAATKAGGIGHQGQLPWHLKADMQHFRDITTKTEQPAAINAVIMGRKTFESIPD
KFRPLHGRLNVVLSTQKPATLNYPPGVLVASSLQEAFEFLDISPEVIETAYIIGGASVYN
EALAKPEYSHYIFMTKVHKDVLCDTVMDMKHLDAYEHDPNFPVQPSLIGVDSGLTTHINL
LTHADKQEHKEDDVEYTISLLRRKQ
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtggcactcgtcgtcgcggccaccaaggctggtggcattggtcatcagggccag
ctgccatggcatctcaaggcggacatgcaacactttcgggacattaccaccaagactgag
cagccagcggccatcaatgcggtcatcatgggccgtaagacattcgagtccatcccggac
aagttccgccccctgcatggtcgcttgaacgtggtgctaagcacccagaagccagcaacg
ctcaactatccgccgggcgtgctcgtggccagttcgctgcaagaagcctttgagtttctg
gacatcagccccgaggtgatcgagactgcctacatcatcggtggcgccagcgtgtacaat
gaggcgctggcaaagcctgagtattcgcactacattttcatgaccaaagtgcacaaggac
gtgctctgcgacacggtgatggacatgaagcatctggacgcttatgagcatgaccccaac
tttccggtccagccatccttgatcggtgttgattcgggactaaccacgcatatcaacctt
ttgacgcacgctgataaacaggagcacaaagaagacgacgtcgagtacaccatctccctt
cttcgtcgcaaacagtaa

DBGET integrated database retrieval system