KEGG   Monosiga brevicollis: MONBRDRAFT_29409Help
Entry
MONBRDRAFT_29409  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mbr  Monosiga brevicollis
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:mbr00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 513 aa AA seqDB search
MAVVEGDRAWLWPDNVDDGAKQEDVPQKVKADLILDLVLISLLSLVAWMTRIYHLSIPAS
VAWDETHFGKFANHYIKNEFYFDVHPPLAKMLIAGAGYLTNYRGDFAFKQPGDAYEQTPY
YGMRLLCATMGSAVVPMGYVAVRVASSARTPALLAAMLLLAETSLLTASRFILLDPIMLF
FIQAALTATFLFRACRTRPFGVWWWTSLATTGVMLGCAISCKFVGLFIVLFVGLYTANDL
WELWGDLRVSIRTWTAHFAARVGTLILLPIIVYLACFWLHFAVCYRSGPGDAFMSSGFQT
TLQGSEIYNRSMPQYIALGSVVTIKQFSHADSMIQQQQVTAYRYRDENNRWLIKTTNPLN
ETHDNYEDMHTQYLIRSGDRIRYAWFIPPPALPVDHQIHKVVTCYGDQGIGDVNDEWIIW
KEDGQHGDHIQPVVDRIRLIHGWENVTRLCALASTGKKLPKWGFEQEAAKAPLTCVIASD
SRPACLYGTLSFTITGGLRKTFPSLKCKVSGPA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggtcgagggagatcgggcttggctgtggccggacaatgttgatgatggagca
aagcaagaggatgtgcctcagaaggtgaaggccgatctaatcctggacctggtcctgatc
agcctcttgagtctcgtggcttggatgacccgcatttatcacctttccataccagccagt
gttgcctgggatgagacacatttcggcaagtttgccaaccactacatcaaaaacgagttt
tactttgacgttcacccaccgttggccaagatgttgattgctggggctggctatttgacc
aactatcggggagactttgccttcaagcagcccggcgatgcgtatgagcaaacaccttac
tatggcatgaggctcttatgcgccaccatgggcagtgcagtcgtccccatgggctatgtg
gccgtgcgagtggcgtcgagtgcgcgcacacccgcgcttctggccgccatgcttctatta
gccgaaacttccttgttgactgcatcacgctttattctactggacccaatcatgctcttc
ttcatccaagctgccctcacggccacctttctatttcgagcctgtcgcacacgacccttt
ggtgtgtggtggtggaccagcttggccacgaccggcgtcatgttgggttgcgccatcagt
tgcaaatttgtgggcttgttcatcgtcctttttgtgggactatacaccgccaacgacctt
tgggagctatggggagatttgcgcgtgagcattcgcacatggacggctcatttcgcggca
cgtgtcggcacgctgatccttcttcccatcatcgtgtatctcgcctgtttctggctgcat
tttgccgtgtgctaccgatcagggccaggggatgcctttatgagctctggttttcaaact
actcttcaaggcagcgagatctacaaccgaagcatgccgcagtatattgccttgggttcg
gtggtgacaatcaagcagtttagtcatgctgacagtatgattcaacagcaacaagtgacc
gcctatcggtatcgggacgagaataatcgctggctcatcaagacaacaaatccgctgaac
gagacgcacgacaattatgaggacatgcacacacaatacctcattcgcagcggtgatcgc
atccggtacgcttggttcatacccccgccagcccttcctgttgaccatcagattcacaag
gtggtgacctgttacggagatcaaggcattggcgacgtgaacgacgagtggatcatctgg
aaggaagatgggcagcatggcgatcacattcagcccgtcgttgatcgtattcgtctgatt
cacggttgggagaatgttactcgtctctgtgcattggcatcgacgggcaaaaagctgccc
aaatgggggtttgagcaggaggctgcaaaggcgccgttgacttgcgtgattgcgtctgac
agtcgtcctgcctgcctttatggaactttgagtttcacgataactggcggtttgagaaaa
acttttccgtcgctcaagtgcaaagtttctggaccagcgtag

DBGET integrated database retrieval system