KEGG   Monosiga brevicollis: MONBRDRAFT_29678Help
Entry
MONBRDRAFT_29678  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
mbr  Monosiga brevicollis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 770 aa AA seqDB search
MSSTGHSSFRRLQPGRLFQWVGEVSLRALERGALVPITTAVQKVETDGVVVPLRIMARAS
KKDQSKKVRPADFNPFLPPDPDLTVCEVTDSHLVLLNKFNVIHHHALLVTKDFVEQSLPF
SAADLEATAVTLQEHNWLVFFNSGPEAGASERHRHLQLVPLPVETGLHADVPIEVLFDPS
LPVHQITRQPRLPFRHAFVAFHADHVTGASLLEFYTQMIDTLGLRLHDAPHLKAHNVLLT
RRWMMIVPRTHEAVHGIALNAMSLAGCLLVRTEDQEATGGAVAVKATRVLGSRRDERLQR
RPRPDVDANANASKADTSSFRPRHHTAPAFQPQRSGSGVMGKWNSKPIVDGAELGSERLF
GLENFGNTCYFNSVLQALYHCQPFRDSLLIHSKSQREGDVTLLDALATLYHKIATSRKRH
GIIQPRQFYACLRQSNASCPHASLTILGPVEIYNSSMQQDAQEFLNYLLNELSEQAVKLA
RRERPAAADAPQKTWVEDLFRGTLTNEIRCLTCETTTTRDEHFLDLSLDIGQNCSLTSCL
RNFSSTETLREDSKYYCEACCSKQEGEKRYSCFHDCALFSPNCLVYASASQGSNDRLRIK
ALPNVLAVHLKRFKYSEQFQNLKKLSCRVAHPVELRVVNTTDDAEDAERLYDLFAIVIHI
GSHLTRGHYIALVKSGMQWLLYDDDRVEAVPESSIEDYFGHTEMQEHQRKTSSTSYLLFY
QARRMSCAFPTFKVTPPSANGTMRGARDADESTSAPVARGLPAAVSNASY
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcactggccacagcagctttcggcgtctccagccgggtcgccttttccagtgg
gtgggcgaggtcagccttcgcgcccttgaacgtggagccctcgtacccatcaccacggcc
gtccaaaaggtcgagacagatggcgtggtcgtcccgctccgcatcatggcccgagcttct
aagaaagaccaaagcaagaaagttcgaccggctgattttaacccttttctacccccagac
cctgaccttacggtgtgcgaggtcacggatagtcatttggttttgttaaacaagtttaac
gtcatccatcatcatgccctcttggtgaccaaagattttgtcgaacagtcattgcccttt
tcagctgccgatcttgaggccaccgctgtgacactgcaggaacacaactggctcgtcttc
ttcaatagtggaccagaggccggtgcctctgagcgacaccggcatctgcaacttgtaccg
ctgcccgttgagacaggtcttcatgccgatgtgccgattgaggtgctgttcgacccctcc
ttgccagtgcaccaaatcacccgacagccgcgtctgccctttcgtcacgcctttgtggcc
tttcacgcggaccacgtgacgggagcttctttgctggaattctacacccaaatgattgat
actttgggcttgcgtctgcacgatgctcctcatctgaaggcacacaacgtcctgctgacc
cgtcgctggatgatgatcgtgccccgcactcacgaggccgtccacggcattgctctcaat
gccatgtcccttgccggctgcctcctcgttcgcaccgaggaccaagaagccacgggcgga
gcagtggcggtgaaggcaacgagagtgctcggctcccgtcgggacgagaggttgcagaga
agaccacgtccagacgtcgacgccaacgccaacgcgagcaaggctgacacgtccagcttt
agacccagacaccacacagcaccggctttccaaccccaacgctcgggctcgggcgtcatg
ggcaagtggaacagcaaacccatcgtcgacggcgctgagctgggctccgagcgccttttc
ggccttgaaaacttcggcaacacctgctactttaactctgtgctgcaagcgctatatcat
tgccagccctttcgggactccctcctcatccactcaaaatcccaacgggagggagacgtc
acactgctcgatgccttggccactctgtatcacaagatagcaacgtcgcgcaagcgacac
ggcatcattcaaccacgccagttttatgcctgtctacgccaaagcaatgccagctgtccg
catgccagcctgacgatcctcggacctgtagaaatctacaacagcagcatgcaacaggat
gctcaggagtttctcaactacctcctcaatgagctgtctgaacaggccgtcaagcttgcc
cgacgagagcggcctgctgctgctgacgccccccaaaagacttgggtggaggatcttttt
cgtggcaccttgaccaacgagattcgctgcctcacctgcgagacgacgacgacgcgtgat
gagcactttctggatttgtccttggatattggtcagaattgcagcttgaccagctgtctg
cgaaactttagctcaactgaaacgctaagggaggattcaaagtactactgcgaggcatgc
tgctccaagcaggagggcgagaagaggtacagttgcttccatgattgcgcgcttttttcc
cccaactgtctagtctatgcgtccgcctcacaggggagcaacgataggctgcgcatcaaa
gcattgcccaacgtgctagcagtacatctcaagcgcttcaagtacagcgaacagtttcag
aatcttaaaaagctctcttgccgcgtcgctcaccctgttgaattgcgcgttgtcaacacg
accgatgatgccgaagatgcggaacgactttacgacctctttgcgatcgtgatccacatt
ggttcacacctcacccgtggtcactacattgctctcgtcaaatcgggcatgcagtggctg
ttgtacgatgatgaccgagtcgaggcggtgcccgagtccagcatcgaggattattttggc
catacagaaatgcaggagcaccagcgcaagacctcgtccacgtcctacctcttgttctac
caagcgcgccgcatgagctgcgcctttcccaccttcaaggtcaccccgccctctgccaac
ggcacaatgcgtggcgcgcgcgatgcggatgagagcacatctgcgccggtggcccgcggg
ctgcctgcggctgtatccaatgcctcatattga

DBGET integrated database retrieval system