KEGG   Monosiga brevicollis: MONBRDRAFT_30786Help
Entry
MONBRDRAFT_30786  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
mbr  Monosiga brevicollis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    MONBRDRAFT_30786
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MONBRDRAFT_30786
Peptidases [BR:mbr01002]
 Metallo Peptidases
  Family M67
   MONBRDRAFT_30786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1068 aa AA seqDB search
MTDHGLKHAKMRLRQLRIDVDRELAFYNVYKTWPSILRLSHDLLRKSLSNDTLSVHSPTY
MVRPVERSYKGLLMAAFFVGANAKVKAVKPEEVEQYQRLVPQLQEVLAKAEAMRTDLLSR
YEREFQAMQQTAARAASHGKLQPSRVFPIAPPLPLGPGDPLAAVKGNTDSIAKTPPASVP
TATAENDLSLQQRLLALQPERSSSSKFSNIEEPLRASSPPTQTTHVGHGGNHAGDLLSTR
IPPTSSETPAPAPTSFPASAVPKRTLDELYASMGDLRLKSNPLEQYHDAIRQPTQRQIMQ
EQALQRLREGEEASPAIDGHLTHQHQIPSSVDSPYQASTATNNTAAYPVYPATAATMHMA
PDHSPQCYWPRSSTHMPSYASYGPSSYGPSSYGPSSSTPALGYYNMSAPTNFPLPSSAMT
PASLSPRDARPGLVQTGTQASVLGCPHGNSTGPVVPRVVEDDPKLARIAYDPILFDQFLT
HARGNSERDQETCGILAGRLQADGSFLLSHVLIPAQSGDANGCQPTEAGDEALFGYQDEH
ELLTLGWIHTHPSQTAFLSSVDLHTTLSYQLMLPEALAVVCSIKYNDIRLFRLTAQGVTE
VLECQQRGHHPHSAQGLFVDSGHTIQRQMPDLVQRDRETERDKRETERQRDRETDRYMYI
LRRLTVTMRATTVACLMAALAASACVSAIDMNLHVMTDKADEGALCLDGSPGAFYHSPAA
SSDDTNKWIIFFQGGGWCYQEVNTVISSYIRCPGTLSPPASHQFCNYNRVQLSYCDGASF
SGDRTDPIIVNGTKLWSRGHRILDATLETLMDMGLVNATDVLLSGCSAGGLATYLHTDYV
HEYLQKKLPNLQRFKAASVSGFFLMHNTTENKPVYPDEMKYVFSMSNATNGVNSDCIADK
SDEDKWQCIFGPETYKYIKAPIFVLNSALDSWQTGCIYTSEYVAANSTQNGACAAAPGWG
SCSGNPEDCTTDQIPAMIQYENDFVKAFDVPTSQAAGNGGFVYSCHTHCAASSNSYYTQF
AINNVTMEQAVSSWWNAPVTDPASAHTYTPCTYNDKLPYRCNPTCGSN
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcatggtctaaagcacgccaagatgcggctgcgacagctccgcattgacgtt
gatcgcgagttggctttctataacgtttacaagacttggccaagtattttgcgcctcagt
catgatctgcttcgcaaatccctgagcaatgacaccctgtctgtgcacagtccaacatat
atggtgaggcccgtggagcgctcgtacaaggggctgcttatggctgcgttcttcgttggc
gccaacgccaaggtgaaagctgtcaagcccgaggaagtcgagcaataccagcgcctagtg
cctcagctgcaagaggttttggccaaagccgaggcgatgcggactgatcttctctctcgc
tacgaacgcgagtttcaggcgatgcagcaaaccgcggcgcgggcggccagccacggcaaa
ttgcagccaagtcgcgtcttccccatagccccaccactgcccctcgggcccggcgatcct
ttggccgccgtcaaaggcaacaccgattcaatagccaagaccccacccgcaagtgtaccc
acggcgacagctgagaatgacttgtcgttgcagcagcgcttattagcacttcaacccgaa
agatcgagcagtagcaaattctccaacattgaagaaccgttgcgagcatcgagccctcca
actcaaaccacgcacgtcggtcacggtgggaatcacgctggcgatcttctcagcacgcgc
ataccacccaccagcagtgagaccccagcgcccgctcccacttctttcccagcctcagcg
gtgcccaaaaggacgttggatgaattgtacgcgagtatgggcgatctgaggctgaaatcc
aaccctttggagcagtaccacgacgctatccgccagcccacacagcggcagatcatgcag
gaacaagccctgcaaaggctgcgtgaaggcgaggaagccagccccgcgattgacggccac
ttgacgcatcagcaccagattccctcgtcagtcgattctccttatcaggcttcgacagca
acaaacaacacagccgcgtatcccgtgtacccagcaacggctgccacaatgcacatggcc
ccggatcactcaccacaatgctactggccaaggtcatcaacacacatgccttcttacgct
tcttatggcccatcatcttatggcccatcatcttatggcccatcatcttccacgcctgca
ttgggttattacaacatgagcgcccctaccaacttcccgctgccttcttcggccatgact
cccgcgagtttgtctcctcgcgatgcgcgcccaggcctcgtccagacaggcacgcaggca
agcgttttaggctgtccacacggcaatagcacggggcccgttgtgccgcgcgtcgtggag
gatgatcccaagcttgcacgcatagcttacgatcccattcttttcgaccagtttctcacg
cacgctcgcggtaacagtgaacgcgatcaggagacttgtggcatccttgctggccgctta
caagcagacggaagctttctgctctcacacgttttgataccagcccagagtggggatgcc
aatggatgccagccgacagaggcaggcgacgaagccctctttgggtatcaggatgaacac
gagctgttgacgctaggatggatacacacgcatccctcacagacggcctttctgtccagc
gtggacctgcacaccacgctgtcatatcagctgatgctacccgaggctttggcagtcgtg
tgttctatcaaatacaacgacattcgcctcttccgtctgactgcacagggcgtgacagag
gtcttggaatgtcaacaacgtggccaccacccgcattcggcacaaggcctctttgtggat
agcggccacacaatacagcgtcagatgcccgatttggttcagagagacagagagacagag
agagacaagagagagacagagagacagagagacagagagacagacagatacatgtacata
ttgcgacgactgaccgtcaccatgcgtgcaacgaccgtggcttgcctgatggcggcgctg
gccgcctcggcctgtgtttccgctattgatatgaacttgcatgtcatgacggacaaagct
gatgagggcgccttgtgcctcgacggctcccctggcgccttttatcattctcccgctgcc
agcagcgacgacaccaacaagtggatcatcttcttccagggcggtggctggtgctatcag
gaggtgaataccgtcatctcgtcttatatccgttgcccgggcaccttgtccccgcccgcc
tcacaccaattttgcaactacaaccgcgtccagctctcctactgtgacggcgcttcgttc
agtggtgatcgcacggatcccattattgtcaacggtaccaagctttggtctcgtggtcac
cgcatcttggatgctactctcgaaacccttatggacatgggcctggtcaacgccaccgat
gtcctcctcagtggttgctcagctggtggtttggccacttatcttcatactgactatgtg
cacgaatatttgcaaaagaagctgcccaatctgcagcgattcaaggccgcctctgtgtcg
ggctttttcctcatgcacaacaccactgagaacaagcccgtctaccccgacgagatgaaa
tacgtcttctccatgtccaacgcaaccaatggcgtcaactcggactgtattgccgacaag
tctgatgaggacaagtggcaatgcatctttggcccggagacctacaagtatatcaaggct
cccatctttgtgcttaattcggccctcgactcgtggcaaacgggttgcatctatacctcg
gagtacgtggctgccaacagcacgcaaaacggtgcctgtgctgcggcccctggttggggc
tcgtgctcgggcaatcctgaagattgcaccacggaccagatccctgccatgattcagtac
gagaacgactttgtcaaggcctttgatgtgcccacttcccaagcggctggcaatggtggc
tttgtgtacagctgccacacgcactgcgctgcctccagcaactcgtattatacccagttt
gctatcaacaatgttaccatggagcaggccgtctctagctggtggaacgctccggtcacc
gacccggccagcgcccacacctacacgccatgcacctacaatgacaagctcccttaccga
tgcaacccaacttgcggctccaactaa

DBGET integrated database retrieval system