KEGG   Monosiga brevicollis: MONBRDRAFT_30836Help
Entry
MONBRDRAFT_30836  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
mbr  Monosiga brevicollis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mbr00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 538 aa AA seqDB search
MNMTASSRIVLVLASLVLLLVTRAYGDQNCSLPDSSKQDCGFVGITQQQCQGKGCCWTPE
EKRVAQDVPWCYYPAAGPSPPSPPSPPSPPLPPSGSPPFNDQEVAQMRAFFKANIDIQGS
GGVVAAPDYNTGPGGSYYYHWARDGALSMHALQITADSSDDYMAQMNHYVRWVVARHAEA
DPHNMDVRVEPKYELPSGDVFAGSWCRPQNDGPGLRALTLMYFANTLIAKGNASLVSQLL
WTGSSSAYQGGAIKFDLDWVAANWQSNTCDLWEEVQSQDFFWNHYTMRKALFTGANFAAA
MNDTASAATYLAAAQAINATITQHDNGQFVYESQNRPKDAAVICAFNNGLMNDGIFQPAS
TPVANTISTLSSLFHDSYNLNQADDAAGVPGILYGRYEGDSYDNGNPWVLTTGCLAELLY
RASAQVLTRGAVLAEEAVAWLGALQSTNRVQLEAQTAEELQDPRVLGRALAQSGDGVLLR
IRYHTQSIGFHMPEQLDKNTGANLSAYDLTWSYATVLKAMKAREDAIAAYRAALFLDA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgacggcgagttcccgcatcgtgctggtgctggccagcctggtgctgctgctc
gtcactcgcgcatacggtgaccaaaactgctccctgcccgacagcagcaagcaagactgt
ggttttgtcggcatcacccagcagcagtgccaaggcaagggctgctgttggaccccagag
gaaaagcgcgtcgcgcaagacgtgccctggtgctattatcccgccgccggccccagcccc
ccgagtcctcccagccccccaagccctccgctccccccatcgggctccccgcccttcaac
gaccaagaagtggcgcagatgcgcgccttcttcaaggccaacattgacattcagggctca
ggtggcgttgtggcggcccccgactacaacaccggccctggcggaagctactactaccac
tgggctcgcgatggcgccctttccatgcacgccctgcaaatcaccgcggatagctctgac
gattacatggctcagatgaaccactatgtgcgctgggtcgtggcccgccacgccgaagcc
gacccgcataacatggacgtgcgcgtggagcccaaatacgagctgcccagtggagatgtt
tttgctgggagctggtgccgcccacagaacgacggtcccggcttgcgggccctgaccctg
atgtactttgccaacacgctcatcgccaagggcaacgcttcacttgtgtctcagctcttg
tggacgggcagcagcagcgcctatcaaggcggtgccatcaagtttgacctggattgggtg
gccgccaactggcagtccaacacctgtgacttgtgggaggaggtccagagccaggacttt
ttctggaaccactacacgatgcgcaaggccttgttcaccggcgccaactttgctgccgcc
atgaatgacacggcctcggccgccacctatctggctgccgctcaggccatcaacgccacc
attacgcagcacgacaacggtcaatttgtgtatgagtcgcagaaccgccccaaggatgcg
gccgtgatctgcgcttttaacaacggcctcatgaacgacggcatctttcagcctgcaagc
acgcccgtggccaacacgatcagcactctatcctcgctgttccatgacagctacaacttg
aatcaggccgacgatgcggctggtgtccccggtattttgtacggccgctacgaaggcgat
agctatgacaacggcaacccttgggtcttgacgacgggttgcttggcggagctgctgtac
cgtgccagcgcgcaggtgctgacgcgtggcgccgtgctggcggaggaggctgtggcttgg
ttgggcgcattgcaatcaaccaaccgggtgcaactcgaggctcagacagcggaggagctg
caggatcctcgtgtgttgggccgtgcactggctcagagtggcgatggcgtcttgttgcgc
atccgctaccacacgcaatccattggcttccatatgcctgagcagctggacaagaacacg
ggagccaacttgagcgcctatgatttgacctggagctatgccaccgtgctcaaggccatg
aaggcgcgcgaagacgccattgccgcctaccgtgctgccctcttcctggacgcgtaa

DBGET integrated database retrieval system