KEGG   Monosiga brevicollis: MONBRDRAFT_30993Help
Entry
MONBRDRAFT_30993  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
mbr  Monosiga brevicollis
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    MONBRDRAFT_30993
Enzymes [BR:mbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     MONBRDRAFT_30993
Protein kinases [BR:mbr01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   MONBRDRAFT_30993
Mitochondrial biogenesis [BR:mbr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    MONBRDRAFT_30993
  Mitophagy factors
   Other mitophagy factors
    MONBRDRAFT_30993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 490 aa AA seqDB search
MSGTGVTRIGQYVLGSTIGKGSFGKVKRAEHAITGHVVAIKIINRDKVKSQDMLDKIKRE
IQILKLFRHPHIIRLYQVVTSPSDIFMIMEHVSGGELFNYILRRRLLPEDEARRFFQQII
SGVDYCHRHMVVHRDLKPENLLLDENLNVKIADFGLSNVMTDGEFLRTSCGSPNYASPQV
ISGLLYAGPEVDVWSCGVILYVLICGKLPFDDDHLPTLFRKIRKGVFQIPSHMSEGARDL
VTQMLNVDPIKRITIDKIREHPWFLIDLPPKLFEHCNIDESSFDKGIVEEICKRFRVYED
HVLDALHSNDPSNQLVIAYKLIADNNRRHAPAIVVNHLTMPCADPSHPIMVRERKKSLIV
PMPSGHAWAGRKIVKRSRWHLGMRSRNRPAEIMGEVYRSLEALNLQWKVITPYHLRCRCW
NQVSGTMMKMSLQLFQSDDQQYLLDFNNLATSEQDRLHALDEDVPQTDTVGFHTLEFFEL
CAMVIAELGR
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaaccggtgtcacccgcatcggccaatatgtgcttgggagcaccattggcaag
ggcagctttggcaaagtcaaacgtgccgagcatgccatcacaggtcacgtcgtggccatc
aaaatcatcaaccgcgacaaagttaagagccaggacatgcttgacaagattaagcgcgaa
atccaaatcctcaagctcttccgccatccccacattatccgcctctatcaagtggtcaca
tcgcccagcgacattttcatgattatggagcatgtttcgggaggcgaactgttcaactac
atcctgcgccgccgcttgctgcccgaagatgaagctcggcgcttcttccaacagatcatt
tccggtgttgactattgtcaccgccacatggtcgtgcaccgcgatctcaagccagaaaac
ctcttgctcgatgagaacctcaatgtcaagattgctgactttggtctttccaatgtgatg
actgacggcgaattcctgcgcacatcatgtggtagccccaactatgcatcaccacaggtc
atctccggcctgctctatgccggtccagaagtggatgtctggagctgtggtgtcattctt
tatgtcttgatctgtggcaagctgccttttgatgatgatcacctaccgactctttttcgc
aaaatccgcaagggcgtctttcaaattccctcccacatgtccgaaggggcccgtgatctt
gtcactcagatgctcaatgttgatcccatcaagcgcattaccatcgacaagatccgcgag
cacccctggttcctcatcgatttaccgcccaagctcttcgagcattgcaacattgatgag
tcgagctttgacaagggtatcgtcgaggaaatttgcaagcgctttcgcgtctatgaggac
cacgtgttggacgccctccacagcaatgaccccagcaatcagcttgtcattgcttataaa
ctcattgccgacaacaatcgccgccacgcccccgccattgtggttaaccatctcaccatg
ccttgtgcagacccttcgcacccaattatggtccgcgagcgtaaaaaaagccttatcgtc
cccatgccgtctggccacgcctgggctggtcgcaaaattgtcaaacgatcgcggtggcat
ctcggcatgcgttcacgcaatcgacctgccgagatcatgggtgaagtctatcgctcgctt
gaagcgctcaacttgcaatggaaggtcatcacaccgtaccacttgcgttgccgttgctgg
aaccaagtcagcggaaccatgatgaagatgagcttgcaacttttccaatctgacgatcag
caatatttgctggatttcaataacctggcgacgagcgagcaagaccgccttcatgcattg
gatgaagatgtaccgcagactgatacagttggctttcatacgctcgagttctttgagttg
tgcgccatggtcattgccgagctaggccgatag

DBGET integrated database retrieval system