KEGG   Monosiga brevicollis: MONBRDRAFT_31027Help
Entry
MONBRDRAFT_31027  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
mbr  Monosiga brevicollis
Brite
Enzymes [BR:mbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     MONBRDRAFT_31027
Protein kinases [BR:mbr01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   MONBRDRAFT_31027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 387 aa AA seqDB search
MGNTLEGGQIDDSRASELGQTLLQDWQRQFDNAYCNPAQRRSASVQDFEQIKTVGTGSFG
RVLLCKYGARNTPVALKILAKATVIQMKQVEHTVNEKNILQGLPDFPFIARLHASFQNPV
NLYMALEYVPGGELFNHLRHQVRYAEPQSLFYASQIVLAFEFLHGLQIMYRDLKPENLLF
TAEGYLKLCDFGFAKRVLDKTWTMCGTPEYLAPEILHMRGYTKAVDFWALGVLIYEMTAV
SREPSNAASTVACTFYKSNRFRIEQGYPPFYAETPMEIYRKILKGQVRWPSHFSQDLITL
LSNLLQPDITKRIGCLRRGVTEIKEQAWFEPIVWSDIFLRRVPAPYTPTLSSDFDTRNYD
QYPEDDIAAGPDGIDPVDLDLDAFQDF
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacacactcgaaggcggccaaatcgacgactctcgtgccagcgaacttggccaa
actctgttgcaagactggcagcgtcaattcgacaacgcctactgcaacccggctcagcgt
cgatcggcgtccgtgcaagactttgaacaaataaagacagtgggtactggctcatttggc
cgcgtcctgctctgcaaatatggcgcgcgaaacactcctgtggccctcaaaatccttgcc
aaggccacagtcattcaaatgaagcaagtggagcacactgtcaacgagaaaaatattctt
caaggcctccctgactttccttttattgctcgtctccatgcctcctttcaaaatcccgtc
aacttgtacatggcccttgagtatgtgccaggtggtgaactcttcaaccatctgcggcac
caagtgcgttacgctgagccgcagtccctcttctacgccagccaaattgtgctcgccttt
gagtttttgcatggcctgcagatcatgtacagagacttgaaacccgaaaatttgttgttc
acggccgagggttacctgaagctgtgcgactttggttttgccaagcgtgtgcttgataaa
acttggaccatgtgcgggaccccagagtatctggctcctgaaatcctgcacatgcggggc
tacaccaaggcagtcgacttttgggcccttggtgtcctcatttacgaaatgacagccgta
agccgtgaaccctccaatgcagctagtaccgttgcttgtaccttttacaagagcaatagg
ttcaggatcgagcagggctatccgccattttatgcggaaacacccatggagatctaccgc
aaaatcctaaaaggccaggtgcgctggccatcccacttctctcaggacctcatcaccctc
ctgagcaacctactgcagcctgatattaccaaacgcattggctgcttgcgacgaggagtg
actgaaatcaaggagcaagcttggtttgagcccatcgtttggtcagacatcttcttgcgc
cgagtgccagcaccttacactcccacgctctcaagcgacttcgatactcgcaactatgac
caatatcctgaggatgacatcgccgctggtccagatggtatcgatcccgtcgatttggac
ttggatgcgtttcaagatttttaa

DBGET integrated database retrieval system