KEGG   Monosiga brevicollis: MONBRDRAFT_31036Help
Entry
MONBRDRAFT_31036  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
mbr  Monosiga brevicollis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 413 aa AA seqDB search
MAFRTAAALRLCRSRHLAVAVTSRTPLMVTLRSLSSVYSATKAITVPWSESAEEQLAAYS
KYKINRLSLQALLDFGKRRDSSEALMQSCNFIHTECPIRLAHMIKEMRTLPDVVLSQPLI
NRVYNWYLLSFKELIDYMPVGADATPQDADAYCQGFTELLERTLLRHRATVITFALGLRQ
LHNKGLLVGREEYITEYLNRFLMARIGIRFVFNQHLALFSHRHQPRDPRDDTTEKVELGS
RWIGSIDPAVRVDDIATDACLNAQQMCYDLYGDAPKFEIIQPREEHNDLSFAYVPSHLYH
ILFELLKNSMRATAEQHDNSPTLPPVRIIIVKGDSDLTVKISDEGGGIAHADVPKLFTYF
YSTAPQPVMFDDEEGLTDMDRAPMAGFGYGLPVARLYSRYFGGDLNLMTVQVR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttcggacggctgcggccctgcgattgtgtcgctcacggcacctggccgtcgca
gtgacctcacgcacgcccctgatggtgaccctgcggtcactgagcagtgtgtacagcgcc
accaaagccatcactgtcccttggtctgaatcggcggaagaacaactggctgcctacagt
aaatacaagatcaatcgcctctcactccaggccctgctcgactttggcaaacgtcgtgac
tcgagtgaagccctcatgcagtcttgcaactttatccacaccgagtgcccaatccgcttg
gcgcacatgatcaaggagatgcgaacgctaccggacgtcgtattgtcacagcccctcatc
aatcgagtctacaactggtatctactgagctttaaggagctcattgattacatgccggtt
ggagcagatgccacgcctcaagatgcggatgcctactgtcaaggttttaccgaacttctg
gagcgcaccttgctgcgacaccgcgcgactgtcatcacctttgctttgggtctgcgccaa
ttgcataacaagggattgcttgttggacgcgaagagtacatcaccgaatatctgaaccgc
ttcctgatggcccgcatcggcatccgcttcgtcttcaatcagcatctggcacttttctcc
catcgccatcaaccccgcgacccccgcgacgacacaaccgagaaagtagagctgggcagc
cgctggattggctccatcgatcccgccgtccgcgttgatgacattgccaccgatgcctgc
ctcaatgcccaacaaatgtgttatgacttgtacggcgatgcacccaagtttgagattatt
cagccccgtgaagagcacaacgatctttcgttcgcatacgtgcccagccatctgtaccac
attctctttgagctgctcaaaaactcaatgcgcgccaccgctgaacaacacgataacagt
cccactctacccccggttcgcatcatcattgtcaagggtgatagcgacttgaccgtcaag
atcagcgatgagggtggcggtattgcccatgccgatgtacccaaactctttacttacttt
tactcgactgcgcctcaaccagtcatgttcgatgacgaggaggggttgacggacatggat
cgtgcccccatggcgggctttggttatggcttgcctgtcgcccggctctactcgcgctac
tttggcggtgacctcaatctgatgactgttcaggtaagataa

DBGET integrated database retrieval system