KEGG   Monosiga brevicollis: MONBRDRAFT_31087Help
Entry
MONBRDRAFT_31087  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
mbr  Monosiga brevicollis
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:mbr03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:mbr03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 174 aa AA seqDB search
MEAAGKGRAGGGGAEGSKRAKGGSAGTPRKTGAKSGAKGDGSKATSRSPAKKGDKRRDGP
PNRGKRPPPRPVARPEDIYIGRNSPFAAQLQRARQLLMSGESRVVLHGLNAAINRCINLA
LQLHREFGGEMTVATDTVALVDDLPPDDPFALPKTAQRPVSAVHITLVRGQRAA
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagcggggaaggggcgcgccggtggcggcggagcggaggggtctaagcgcgcc
aagggaggtagcgctggtacaccacgcaagactggagcaaagtctggtgccaagggtgat
ggtagcaaagccacgagtcgctccccagcaaaaaaaggcgacaagcgccgagatggccct
ccgaataggggcaagcgcccacctccccgcccagtggcgcgcccagaggacatttacatt
ggacgcaattcgccctttgcagcacagctgcaacgagctcgccagctgctcatgagcggg
gagagccgtgtggtcctacatggcctgaatgctgccatcaaccgctgcatcaatttggct
ctgcagctacaccgtgaattcgggggcgagatgaccgtggccacggatacagtcgcgctc
gtggatgatctccccccggatgacccgtttgccctccccaagacagctcagcgacctgtt
tctgcggttcacatcacgctagtgcgcgggcaacgtgctgcctga

DBGET integrated database retrieval system