KEGG   Monosiga brevicollis: MONBRDRAFT_31087Help
Entry
MONBRDRAFT_31087  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
mbr  Monosiga brevicollis
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MONBRDRAFT_31087
   03008 Ribosome biogenesis in eukaryotes
    MONBRDRAFT_31087
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     MONBRDRAFT_31087
Ribosome biogenesis [BR:mbr03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     MONBRDRAFT_31087
Transfer RNA biogenesis [BR:mbr03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    MONBRDRAFT_31087
Mitochondrial biogenesis [BR:mbr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    MONBRDRAFT_31087
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 174 aa AA seqDB search
MEAAGKGRAGGGGAEGSKRAKGGSAGTPRKTGAKSGAKGDGSKATSRSPAKKGDKRRDGP
PNRGKRPPPRPVARPEDIYIGRNSPFAAQLQRARQLLMSGESRVVLHGLNAAINRCINLA
LQLHREFGGEMTVATDTVALVDDLPPDDPFALPKTAQRPVSAVHITLVRGQRAA
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagcggggaaggggcgcgccggtggcggcggagcggaggggtctaagcgcgcc
aagggaggtagcgctggtacaccacgcaagactggagcaaagtctggtgccaagggtgat
ggtagcaaagccacgagtcgctccccagcaaaaaaaggcgacaagcgccgagatggccct
ccgaataggggcaagcgcccacctccccgcccagtggcgcgcccagaggacatttacatt
ggacgcaattcgccctttgcagcacagctgcaacgagctcgccagctgctcatgagcggg
gagagccgtgtggtcctacatggcctgaatgctgccatcaaccgctgcatcaatttggct
ctgcagctacaccgtgaattcgggggcgagatgaccgtggccacggatacagtcgcgctc
gtggatgatctccccccggatgacccgtttgccctccccaagacagctcagcgacctgtt
tctgcggttcacatcacgctagtgcgcgggcaacgtgctgcctga

DBGET integrated database retrieval system