KEGG   Monosiga brevicollis: MONBRDRAFT_31676Help
Entry
MONBRDRAFT_31676  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00220  Arginine biosynthesis
mbr00250  Alanine, aspartate and glutamate metabolism
mbr01100  Metabolic pathways
mbr01200  Carbon metabolism
mbr01210  2-Oxocarboxylic acid metabolism
mbr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MONBRDRAFT_31676
   00220 Arginine biosynthesis
    MONBRDRAFT_31676
Enzymes [BR:mbr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MONBRDRAFT_31676
Amino acid related enzymes [BR:mbr01007]
 Aminotransferase (transaminase)
  Class I
   MONBRDRAFT_31676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 5889581
NCBI-ProteinID: XP_001744315
JGI: 31676
UniProt: A9UV48
AA seq 534 aa AA seqDB search
MASAPVLARAWARPSAHFLRPLSRTLASSRPISQGAQAAVANDASTQGPSFKFEDLNPHL
VAAEYAVRGLLPQRAAQIAQELQQGATNYPFDEVIFANIGNPQALAQPPITFFRQVLSLM
ENENMLLDMANFPHVAALYPADVIARAKDYIRAGADIGAYSASQGVPLVREQVAGYLERR
DGVPADPSDIFLTAGASEGISNLLGAIIANPSVGIMIPIPQYPLYSATITLCNGKPVKYY
LDEEAGWTLNADELKRQLDEARAAGTDVRALCVINPGNPTGQVLTEDVMREVVQFCRRER
LVLLADEVYQANTYQDHLPFHSFKKVVASMPDCRDTVELASFHSLSKGMIGECGRRGGFM
ELINFDPLVREQLLKRASINLCCNVAGQVMTGMMCEPPAVGEPSYDLYHHEMESLYTSLR
RRALILADAFNDMDGIECGQPQGAMYLFPRIYLSDKAIAAAQERKLAPDTFYCLQLLERT
GFCVVPGSGFDQYPGTFHFRCTFLPQEEKIASLVHSIQEFQRDWVEEYGLPSMA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgcccctgtgcttgcccgtgcttgggcgcgacccagcgcacatttcctgcgg
ccactgagtcgaacgcttgcctcaagccgccccatctctcaaggcgcccaggctgccgtg
gcaaacgatgcctcgacacaaggcccctcattcaagtttgaggacttgaacccccacttg
gtggcggccgagtatgctgtccgtgggcttttgcctcagcgtgcggcccaaattgcgcag
gagctgcagcagggcgctaccaattatccctttgatgaggtcattttcgccaacattggc
aacccacaggccttggcacaaccgcccatcacctttttccgccaagtcttgtcgttgatg
gagaacgaaaacatgcttctggacatggccaacttccctcacgtggctgccctctacccg
gccgatgtcattgcgcgtgccaaagattacatcagggcgggtgccgacattggtgcttat
tctgcctcccagggcgtgcccctggtgcgcgagcaagtggccgggtaccttgagcgtcgt
gacggcgtccctgccgacccaagtgacatttttctgactgccggcgcttcggaaggcatt
agcaatcttctcggtgccatcatcgccaatccctctgtgggaattatgattccgattcca
caatatccactgtacagcgccaccattactctttgcaacggcaagcccgtcaagtactat
ctggatgaggaggctggctggactctcaatgccgatgagctcaagcgtcagctggacgag
gctcgggccgctggcaccgatgtgcgcgcgctctgtgtgattaaccctggcaacccaacc
ggtcaagtgctcaccgaagacgtgatgcgcgaggtggtgcaattttgccgtcgtgagcgt
ttggtgctgctggccgatgaggtgtaccaggccaacacctatcaagatcaccttcccttc
cattccttcaaaaaagtcgtagccagcatgcccgactgccgtgataccgtcgagctggct
tctttccatagcctgagcaagggcatgattggcgagtgcggtcgccgtggtggcttcatg
gagttgatcaattttgatccgttggtgcgcgagcagctcttgaagcgggcttccatcaac
ctctgctgcaacgtggccggtcaggtcatgaccggcatgatgtgcgagccgccagccgtg
ggtgaaccctcctatgacctctatcaccacgaaatggagagcctttatacttcccttcgc
cgtcgtgccctcattttggccgatgccttcaacgacatggacggcattgagtgcggccaa
cctcagggtgccatgtacttgtttccgcgcatttatttgtccgacaaggccattgccgcg
gctcaggagcgcaagctggcacctgacaccttctactgcctgcagctgttggagcgcact
ggtttctgtgtggttcctggtagtggcttcgaccaatatccaggtacctttcacttccgc
tgcaccttcttgcctcaggaggagaagattgccagcttggttcacagcatccaggagttc
cagcgcgactgggttgaggagtacgggcttccctcgatggcttga

DBGET integrated database retrieval system