KEGG   Monosiga brevicollis: MONBRDRAFT_31810Help
Entry
MONBRDRAFT_31810  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mbr  Monosiga brevicollis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MONBRDRAFT_31810
Enzymes [BR:mbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MONBRDRAFT_31810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 393 aa AA seqDB search
MTASGTNDSQLRLPHIIASKRDGKALSPEQIHHFVKGVVSGSVAAEQIGALLMAIYCKGM
DWQETTELTSALLHSGTTLSWDTPHPIVDKHSTGGVGDKISLVLAPALAACGCWVPMISG
RGLGHTGGTLDKLEAIPGFSVSQSKEDMEQILSKAGACIVGQTELIVPGDRILYAARDIT
STVGSLPLIVASIMSKKVAEGLQHLVLDIKVGSAAFMQTEKQARELAEAMVEVGCNLNIE
TTAVLTEMDCPIGKAVGNAVEVVESIRALKGEGPADLLELVTVEGGQLLMQAGLATNLEH
GRELIANSLQDGTALKAFRTMCEAQGVSSDTAAEICEQPEAVLLKATKQQTTIKASTSGF
VQHIEAMPLAEVLGELGAGRQHPVSLNIAVEPS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgtcggggaccaacgattcgcagctgcggctgccgcacatcatcgcctccaaa
cgggatggcaaggccttgagccccgagcagattcatcactttgtcaagggtgtcgtcagc
ggatccgtggctgcggagcagattggcgccctgctcatggccatctactgcaagggcatg
gattggcaagagaccacggagctgacctcagccctcctccactcgggcacaaccctgagt
tgggacaccccacatcccattgttgacaagcactcgacgggcggcgtaggcgacaagatt
tcgctggtgttggccccagctctcgcggcctgtggctgctgggtgcccatgatctcgggc
cgtggcttgggtcacactggtggcactctggacaagcttgaagcgattcctggcttcagc
gtatcgcagtccaaggaggacatggagcaaatcttgagcaaggctggggcctgcatcgtc
ggtcaaaccgagttaatcgtgccgggcgaccgtatcctctatgcagcccgtgacattacc
agcactgtgggcagcctgcccctcattgtggccagcatcatgtctaagaaggtggccgag
ggcctgcagcaccttgtccttgatattaaggttgggtcagcagcctttatgcagacggag
aaacaggcccgtgagttggccgaggccatggtcgaagttggctgcaacctgaacatcgag
accactgccgttctcactgagatggattgccccatcggcaaagccgtgggtaacgccgtg
gaagtagtcgagtccattcgggcgctcaagggcgagggcccggccgacttgttggagctt
gtgacggtcgagggcggccaactgctcatgcaagcgggtctggcaaccaacctggagcat
ggtcgcgagctcattgccaactccctccaggatggcacagccctcaaggctttccgcacc
atgtgcgaggcccagggcgtgtcctcggacactgcagccgagatttgcgagcaacccgaa
gcggtgctgctcaaggctaccaaacagcagaccactatcaaggcatccaccagcgggttt
gtacagcacattgaggccatgccgttggcggaggtgttgggagagctgggcgctggacgc
caacatccagtaagtttaaacattgcggtggaaccgagttga

DBGET integrated database retrieval system