KEGG   Monosiga brevicollis: MONBRDRAFT_32350Help
Entry
MONBRDRAFT_32350  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mbr  Monosiga brevicollis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mbr00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mbr00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mbr00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:mbr00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 423 aa AA seqDB search
MAATMVLTVLAVMASMVAAYDNGVALKPALGWNTWCTLSDCHNGDNNYFDRCNEWELREI
AEAMLSNGMHDLGFQYINLDDCWAAQERDSNGNIQPDPSRFPSGMKAMADWLHEKGLKFG
LYTSMGTETCNHGGRPLPIPGSFGHYAEDAKTFAEWGMDYVKVDWCGGELNDAQTQHTEL
SKALNATGRPIWLELCRGYSYDPIPDYVTEVAQSWRITGDHQDEWSNTKTVIEGFMIPSN
QAGPNQWNYGDFLMTGGPGCNLNNSDHCPFSSDDEYRTSFSVWTISSSPLIVSTDIRNMT
AVMKQCLLNKQAIAINQDHESTPGRLIGQAADANCIASDLRTGDCPIFGRKLSDGTYAAV
LLNFADQGTRTVTLPFNWLGVASNQTMAVYDILEQKSLGNFTGSFTAKDLNPHQSIFLSL
TAA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacgatggtgttgacggtgctggccgtgatggcctcgatggtggctgcctat
gataatggtgtggcgctcaagccggctctgggttggaatacctggtgcaccctttcggat
tgccacaacggagataacaactactttgatcgctgcaacgaatgggagctgcgtgagatt
gccgaggccatgctgagcaacggcatgcatgatctgggctttcaatacatcaacttggac
gattgttgggctgctcaggagcgcgactccaatggcaacattcagccagatccgtcgcgc
ttcccttcgggcatgaaggccatggcggactggctccacgagaagggactcaagtttggc
ctgtacacctccatgggcacggagacgtgcaaccacggtggtcgcccccttcccattcct
ggctcctttggacactacgccgaagatgccaagacctttgccgagtggggcatggattat
gtcaaggtggattggtgcggtggtgagctcaacgatgctcaaacgcagcacacggagtta
tccaaggcactcaacgcaaccggtcgccccatctggctggagctttgccgcggctactcg
tatgaccccattcctgactacgtgacagaggttgcccagtcgtggcgcatcacaggtgac
caccaagatgagtggagcaacaccaagaccgtgattgagggctttatgattccctccaac
caagcgggcccaaaccagtggaactatggtgatttcttgatgaccggtggccctggctgc
aatttgaacaactcggaccattgccccttttcttcggatgatgaataccgcacctccttc
tcagtgtggactattagcagcagtcccttgattgtgagcacggacattcgcaacatgacg
gccgtcatgaagcagtgccttctcaacaagcaagccatcgccatcaaccaggatcacgaa
tcgacgcctggacgcctgattggccaggcggccgatgccaactgcatcgcgtcggatctt
cgcacgggtgactgccccatctttggccgcaaactctcggacggcacttatgctgccgtg
ctcctcaactttgccgaccaaggtacgcgcacggtgacgctacccttcaactggctgggt
gtggcgagcaaccagacgatggccgtgtatgacattttggagcaaaagtctttgggcaac
tttactggcagcttcacggccaaggatctgaacccccaccagtccatcttcctgtccctg
accgcagcctaa

DBGET integrated database retrieval system