KEGG   Monosiga brevicollis: MONBRDRAFT_32506Help
Entry
MONBRDRAFT_32506  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00920  Sulfur metabolism
mbr01100  Metabolic pathways
mbr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MONBRDRAFT_32506
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MONBRDRAFT_32506
Transfer RNA biogenesis [BR:mbr03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MONBRDRAFT_32506
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-GeneID: 5891348
NCBI-ProteinID: XP_001746029
JGI: 32506
UniProt: A9UZZ2
AA seq 343 aa AA seqDB search
MAAATKTSTTSLAALGDAAVAAVRAVVAASRVCETVRTGELMQSMSKDDKSPVTVADFAA
QAIVIHELHAFDASIPVVGEEDADALRGDAEEATQLRQKVMSAVHSLRTDLDEAAVLGAI
DRGNYEGGASGRFWALDPIDGTKGFLRNDQYAVALGLVEDGQVVLGVLGCPNLREDLDNP
ESVRGCGYVAKRGEGCFKFNLDNCESLTKATVTSPPAEEVRLVESVETKHTSHDTSAQIK
AAANIKGDSVRMDSQAKYAVVGRGDAHLYLRLPRAGSTHEEKIWDHAGGMLIVEEAGGRV
TDIHGKPLDFGQGQTLKNNTGVVASNGVVHDAVIAALAEIYKN
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggcgacaaagacatcaacgacgagcttggcagcgctgggagatgctgctgtg
gctgccgtgcgtgcggtggtggctgcctcgcgggtctgcgagacggttcgcactggcgag
ctgatgcagtccatgtccaaggatgacaagagtcccgtgacggtcgctgattttgccgct
caggccatcgtgatccatgagctgcatgcttttgacgccagcattcctgtcgttggtgaa
gaggatgcggatgccttgcgtggcgatgcggaagaagccactcagttgcgtcaaaaggtc
atgtcagcggtccattcgctgcgtacagacctcgatgaggctgctgtgctcggtgccatc
gaccgtggcaactacgaaggaggtgcctcgggccgtttctgggctcttgaccccatcgac
ggcaccaaaggctttttgcgcaacgaccagtatgctgtggcactgggcttggtcgaagac
ggccaagtggtgctgggggtcctaggttgccccaatctgcgcgaggatctggacaatccc
gagtccgtccgtggttgcggatacgttgccaagcgcggcgaaggctgcttcaagtttaac
ctcgacaactgcgagtccctgaccaaagctaccgtgacttcgcctcctgccgaggaggtt
cgcctggttgaatccgtcgagacaaagcacacctctcacgacacgagcgcgcagatcaag
gccgccgccaacatcaagggcgactctgttcgcatggatagccaggccaagtatgctgtc
gtgggtcgcggggatgcacacctgtacctgcgcttgccccgggcaggctcaacgcacgag
gagaaaatctgggaccatgctggtggcatgctgattgtcgaggaagccggtggccgcgtc
acggacatccatggcaagcccctcgattttggccaaggccagacgctcaagaacaacaca
ggtgtcgtcgcaagcaacggcgtggtccacgatgcggtcatcgcagcactcgccgaaatt
tacaagaactag

DBGET integrated database retrieval system