KEGG   Monosiga brevicollis: MONBRDRAFT_32541Help
Entry
MONBRDRAFT_32541  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
mbr  Monosiga brevicollis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 449 aa AA seqDB search
MSAAMEVTQPKLSAASRSLKSASSVSGANHASAARASVKNEFPLTPSKALERYGRYLTAF
EEQEIQAYQQIWYVGQLARKINASEGKGPNCGYDDDKGRYKCIKHDHIAYRYEILKGLGK
GSFGDVVKAYDHKTKQHRAVKIIRNERRFHRQAQVEVKVLELLKRNDRRHNHNLIHINDW
FLFRNHLCISFDMLHQDLYTALKKDGFRGFTLPQVKKFAGSLLNCLRLLRRQRVIHCDLK
PENILLTTSESDDIKVIDFGSACLDHQKVHTYIQSRFYRAPEVILGLGYSMAIDMWSLGC
ILVELYTGHPIFPGRDEKEQLMYQIEVLGMPPGPILEAAKRTAIFFDSNGDLRVTTDRKG
RTHTPSSKTLQEAVGVNDELFIDFLHGCFEWDPSDRMTPKEATKHPWITGIVESDEPLEP
NLEAALGAMTVTAAAPMPSVVKLSTDMQP
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgccatggaggtgacacagcccaagttgagcgccgctagccgctcgctcaaa
tccgctagctcagtctcgggcgccaatcacgcgtcggccgcgcgcgcctctgtcaaaaac
gagtttcccctcactccctccaaagctctcgagcgctacggccgctacctgactgccttt
gaagagcaggaaatccaggcttatcagcaaatttggtatgtcggccagttggcccgcaaa
atcaatgcctcagagggcaagggccccaactgtggttatgacgatgacaagggtcgctac
aagtgcatcaagcacgatcacattgcctatcgttacgagatcctcaaaggccttggcaaa
ggctctttcggtgatgtcgtcaaggcctacgatcacaagacgaaacagcatcgtgccgtc
aagattattcgcaacgagcgccgcttccaccgccaagcccaagttgaggttaaggtcctc
gagcttctcaagcgcaacgaccgtcgtcacaaccacaacctcattcatatcaacgactgg
ttccttttccggaatcacctctgcatctcctttgacatgctgcaccaggacctctacacc
gccctgaagaaggacggtttccgtggtttcaccctgccccaagtcaagaagtttgcgggc
tccctgctcaactgcctccgccttcttcggcgccaacgcgtgatccactgcgatctaaaa
ccagaaaacattctgctcaccacgagcgagtcagatgacatcaaggtcattgactttggc
agcgcctgccttgaccaccaaaaagtccatacctatattcaaagccgtttctaccgcgcc
cccgaagtcatcctaggcctgggctacagcatggccattgacatgtggagcctcggctgc
atcctcgtcgagctgtacacgggccatcccatctttcccggtcgcgatgagaaggagcag
ctcatgtatcagattgaggtgctcggcatgccccccggcccgattctcgaagccgccaag
cgcaccgccatcttcttcgactccaacggtgatctgcgcgtgactactgatcgcaaaggc
cggacccatacacccagctccaagacgcttcaagaggccgtgggtgtcaacgacgagctg
tttatcgactttcttcacgggtgtttcgagtgggatcccagcgatcgcatgacccctaaa
gaagccaccaagcacccctggattaccggcatcgtcgaatccgacgagccgctcgagccc
aaccttgaagcagcactcggcgccatgaccgtgacggctgctgctcccatgccatccgtc
gtcaagctttctactgacatgcagccttga

DBGET integrated database retrieval system