KEGG   Monosiga brevicollis: MONBRDRAFT_32697Help
Entry
MONBRDRAFT_32697  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
mbr  Monosiga brevicollis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MONBRDRAFT_32697
Messenger RNA biogenesis [BR:mbr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     MONBRDRAFT_32697
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     MONBRDRAFT_32697
Translation factors [BR:mbr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    MONBRDRAFT_32697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 214 aa AA seqDB search
MSDEIPLRYSWTFWYSNKKQRNRDNFDASMQKMCTVSTVKEFWNVYSFLQRPSELPICDL
MLFRDGIRPVWEDDKNKSGGRWSLHLKKGIQASSRAWENLLLAIIGDQFTHSEEVCGVVL
KIRQSDDSLCLWNRTASDAETRTTIGKDLRKVLRLDSGVLIKYKFHEQTEQPEDEITLLL
FQPERGGPQPEAKPVAIDNERRTTCHTSNQTQFS
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgagattccgctccgctattcctggaccttctggtactcgaacaagaagcag
cgtaatcgcgataatttcgacgcttcaatgcagaaaatgtgcaccgtgtccacggtcaag
gaattctggaacgtttacagctttctgcagcgtccgagcgagcttcccatctgtgacctc
atgctctttcgcgatggtattcgccccgtctgggaggacgacaagaacaagagcggtggc
cgatggagcctgcacttgaagaagggcattcaagcctcgtctcgagcttgggaaaatcta
cttctggccattatcggcgaccagtttacccattctgaggaagtttgtggcgttgtgctc
aagattcgccagagcgatgactctttgtgcctctggaaccgcacagccagcgatgccgaa
acgcgaacaaccatcggcaaggaccttaggaaagtgctgcgcttggacagcggcgtgctg
atcaaatacaagtttcacgagcaaaccgagcagcctgaggatgagattactcttcttctc
tttcaaccggagaggggagggccccagcccgaggccaagcctgtggccattgacaacgag
cgtcgcaccacctgtcacacatccaaccaaactcaattcagctga

DBGET integrated database retrieval system