KEGG   Monosiga brevicollis: MONBRDRAFT_32982Help
Entry
MONBRDRAFT_32982  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
mbr  Monosiga brevicollis
Brite
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MONBRDRAFT_32982
Peptidases [BR:mbr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   MONBRDRAFT_32982
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 328 aa AA seqDB search
MAGRWCLMESDPGVFTDLIEGVGVKGVQVEELWALDVDALKQLAPVYGLVFLFKFTPEAH
KSETQPIDYKIPGLFFAHQVINNACATQAILSILLNAPDIELGEHLTGFKSFANELDPET
AGLAISNSEELRTVHNSFSRQETFTMEEKVADKDDDVYHFIAYVPHGGRLYELDGLQRGP
IDHGPVGEEWVETVVPVLQKRIERYTSTEIRFNLMAVCRDRREALEEEKENAESMALSLP
EASPEAAEWQAKAAEFEAQLQQEHAKRQNWKDENRRRKHNYIPFILELMRSLAREKRLQP
LVAEAKRKAVERLDQQKRTGTEPKTPKQ
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggctggtcgttggtgcttgatggagagtgaccctggcgtcttcacggaccttatcgag
ggcgttggcgtcaagggtgtgcaagtcgaggaactttgggctttggacgtggacgcgctc
aagcagctggcacccgtctacggtttagtgtttctcttcaagtttacgcctgaggcgcac
aagtcggagacgcaacccatcgactacaagatccccggcctattttttgcgcaccaagtc
atcaacaatgcctgcgccactcaggccatcctgtccattctcctcaacgctccggacatt
gagctcggtgaacatttgactggcttcaaatcatttgccaatgagttggatccggagacg
gccggcctggccatcagcaacagcgaagaactacgcactgtccacaacagcttctcgcgt
caagagactttcacaatggaagagaaggtggcggacaaggatgacgacgtgtatcatttt
atcgcttatgtaccccatggcggtcgcctgtacgagctggatggactacaacgcggtcca
atcgatcacggaccggtgggcgaagaatgggtggagacggttgtgccggtactgcagaag
cggattgagcggtacacgtccacggagattcgcttcaacctcatggctgtgtgccgcgat
cgacgagaagccctcgaggaggagaaggagaatgccgagtccatggcattgtccttgccg
gaggcgtcgcccgaggcagccgaatggcaggccaaggccgcggaatttgaggctcagctt
cagcaagagcacgccaagcgtcagaactggaaggacgagaaccgccgccgcaagcacaat
tacatcccctttattttggagctcatgcgcagcctggcccgggaaaagcgtttgcagccg
ctggtagccgaagccaagcgcaaggccgtcgagcgcctcgaccaacagaagcgcaccggc
accgagcccaagacccccaagcaatag

DBGET integrated database retrieval system