KEGG   Monosiga brevicollis: MONBRDRAFT_33064Help
Entry
MONBRDRAFT_33064  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K13510  
lysophosphatidylcholine acyltransferase / lyso-PAF acetyltransferase [EC:2.3.1.23 2.3.1.67]
Organism
mbr  Monosiga brevicollis
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:mbr00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:mbr00565]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 475 aa AA seqDB search
MAARAPRVGYVEKQRRRGLRSGRISVTSVAPPEPTLDPFRIDTAKAGSSDYFKLFVTGPI
LIPLRIILICIILLLANAWAFLLSIGATVDIHHPEKLATWRVKLALPVICFLARSILFVL
GFYYIEVKGQPAPTKARREALSLPGTARFMLVNQSFVAPLAVCNHLSYFEPFALISLGYA
HVSKSQVAAQWYWRLPMVFLQTLAVTREDRNSSSKAVNAIASHADRCLKGDLSMPLMIYP
EGTTTCGNAICRFKTGAFRPGVPIQPVVLRLFYTHFNPSESFESELWFWRAFSQYAYHMK
LEFLPVYYPTEEELDDHHLYADNVRRIMARKLNLHSADYSMYDVLLQYNARKLGLPPLLC
SVEWGYFADNFDLRMEFANGAMEIFADMNTTKDALLTLNQLYAGTAWLQPPTLLVSWCLL
KLGIKVDYEDVADLLADHEQALTFRQFLYLICDRQAPLDQIQIKPRASSIESKTR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcgggctccacgcgtcggctacgttgaaaagcaacggcgccggggtttacga
agtggtcgcatttccgtcaccagcgtggctcctccggagcccactctcgatccctttcgc
atcgacacggccaaggctggctcctctgactactttaagctcttcgtcacgggtcccatc
ctcatcccacttcgtatcatcctcatctgcatcattctccttttggccaatgcttgggcc
tttctcctcagcatcggggccaccgtggatatccaccatcccgagaagctcgccacttgg
cgagtcaagctggcccttcctgtcatctgcttcctcgcccgttccatcctttttgtgctg
ggattctattacatcgaagtcaagggccaacccgcgcccacaaaggcaagaagagaagcc
ctctcccttcccggcactgcccgcttcatgctggtcaatcagtcatttgtggctccgctc
gctgtttgcaaccacttgtcctactttgaaccctttgcactcattagcctcggctatgcc
cacgtgtccaagtctcaagtcgcggcgcaatggtactggcgcctgcctatggtctttctt
cagaccctggcggtcacccgcgaagatcgcaactccagctccaaggccgtcaacgccatc
gcctcccatgcggacaggtgcttgaagggcgaccttagcatgcccctcatgatctatcct
gaggggaccacaacatgcggcaatgccatctgtcgcttcaagaccggagcttttcgccca
ggcgttcccattcaacccgtcgtgctgcgtctgttctatactcacttcaacccctcggag
agctttgaatcggaactctggttttggcgcgctttctcccagtatgcctatcatatgaag
cttgagtttttacccgtgtactatcccaccgaggaagagcttgatgatcatcatctgtac
gccgataacgtgcgccgcatcatggcccgaaaactcaacctgcattctgccgactactcc
atgtacgacgtcctccttcaatataacgcccgcaagctcggtctgcctccgctcttatgc
tccgtcgagtggggctactttgccgataattttgaccttcgcatggagtttgccaacggt
gccatggaaatctttgccgacatgaacacgaccaaggatgccttgctgaccctcaaccag
ctctacgcaggcacggcatggctccaaccgcccacgctactcgtgtcatggtgtctgctc
aagcttggtatcaaggtggattatgaagacgtggcggacttactcgcagatcacgagcaa
gcactcacctttcggcagtttctgtacttgatctgtgatcgccaagcgccattggatcag
attcagatcaaaccgcgagctagctccatcgagtccaaaactcgttga

DBGET integrated database retrieval system