KEGG   Monosiga brevicollis: MONBRDRAFT_33163Help
Entry
MONBRDRAFT_33163  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
mbr  Monosiga brevicollis
Brite
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MONBRDRAFT_33163
Peptidases [BR:mbr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MONBRDRAFT_33163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1125 aa AA seqDB search
MGRAGKMKKKQGHGGPANPKWQRDRQQNGKTCAQKQDDISLSSALSLLSLSLLSLLSLCS
LSLLSLGSLSALSLLSALSLLSLCSLCSLSLSALSVCFTWPHLRGNQKYWNMKMAFEPAR
DPAAASGGMANSKLKPLNRKQANSNAAAHAAASTQPGSGAALPAPRKILFDEMFWPACIN
AAPALYLDQLQLNWQQTRRIGPGLVNMGNTCFLNAVLQCLTYTPALAQFLLSDDCTRMSR
NKGPDALHNLATHVRRALSSSAGPSITPQAIVSKLRTIYKRFRLGRQEDAHEFMRFLIEA
LQKSAVSTVGQLDERSKTTSVIHGIFGGYLRSQVRCLSCKYESNTYDPFLDLSLEIGKCQ
TLDKALRHFFSPEKLLRENQYRCDGCRKYVDALKQFSCHHLPNVLTVQLKRFSFISMFGS
KVGQFVQYPEILDMAPYVNKTQQASMTDRGTRYRLYAVLVHAGHSLQSGHYYCYVRNSNN
IWYRMDDARVSTASQQEVMRQQAYILFYTRIANPRPSAPVVAKADAQAKPKATEPKPKAT
PPLASDPITSEEDGRPQAKRVAREAAETVPDKATLVGLSSLPRAAQPDSDDSDDDMANAV
ASSGAGSNPVDPVLMATHTEWNITYKISAASATIDEISEINLFQVVEPTKWHEANARRER
AKQRQQRVRQVIERQRRLLDQRLQLHGDEVDSDLEDSLSESSESLNDADADDWAAHLLDV
AKIMGNGSTLTQSAAAIESDESDDEWVPPGEQAAPSGSEDSMTDSAPEESGSTPMPAQAP
PSYLEAVRASLGSELGPMLDEETLELLAQADPEVQAQMKQPLHEVLEQSLVVVQDAMLEQ
TLDEDEQVVYDGKLTVETCPPHLLAYVKQQVSAAARQLLEDIYLTDEEENDLATGSAANS
DSDDDEESDAPDFAPESESTPALDGVDDPLLASDSDDDVDVAIDGAPVASTASSRVQEYE
YVPDAGLPRHSNATLGWDGKRRVGVAQSLAETNDGVLSWEGAMSSALDGEQPAQRAAVDA
ADELEREEYDEDYDRGRVKKVKTGKKTGPVDLSQQLQHSHNRLKNLKGLNLTKGLRNDRG
RGGGRGGGRGGRGGRGGRGGRGGGRGGGRGRGGRGGRGGRGGGRR
NT seq 3378 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtgcaggcaagatgaagaagaagcagggtcacggtggccctgccaaccccaaa
tggcagcgcgaccgtcaacagaacggcaagacatgtgcgcaaaaacaggatgacatctct
ctctcttctgcgctctctctgctctctctctctctgctctctctgctctctctctgctct
ctctctctgctctctctcggctctctctctgctctctctctgctctctgctctctctctg
ctctctctctgctctctctgctctctctctctctctgctctctctgtctgcttcacgtgg
ccgcacctacgtggcaaccaaaagtactggaacatgaagatggcctttgagccagcccgt
gatcccgctgctgctagtggcggtatggccaacagcaagctgaagcccctcaatcgcaaa
caagccaacagcaacgctgccgcccatgccgccgccagtactcagcccggctcgggtgcc
gctctgcccgccccccgcaagattctctttgacgagatgttctggcccgcctgcattaac
gcggcacccgccctctatttggatcaacttcagctcaactggcagcagactcgccgcatt
ggccctggcctcgtcaacatgggcaacacgtgcttcctcaacgctgttctccaatgtctt
acgtacacacctgccttggctcagtttctgctctcggacgattgcacccgcatgtctcgc
aacaagggtccagatgctctgcacaacctggccacccatgtccgccgcgccttgagctct
tcggctggacccagcataacaccccaagccatcgtctcgaagctccgaaccatttacaag
cgcttccgccttggtcgtcaagaagatgcccacgagtttatgcgcttcctgattgaggct
ttgcaaaagtcggccgtcagcaccgtgggccagcttgatgagcgcagcaagacgacctca
gtgatccatggcatctttggcggctatctgcgctcccaggtgcgctgcttgagctgcaag
tacgaatccaacacctatgatccttttttggacctctccctcgagattggcaaatgccag
acgctggacaaggccttgcggcattttttcagccctgaaaagcttttgcgggaaaaccag
taccgctgtgatggctgccgcaaatacgtggacgctctcaaacagttctcctgccaccac
ctgcccaacgtgctgaccgtccaactcaagcgtttcagcttcatcagcatgtttggttct
aaggtgggccagtttgttcagtacccggagattctggacatggctccctacgtcaacaaa
acccagcaagcaagtatgacggaccgaggaacccgttatcgcctctacgctgtgctggta
catgcaggccactcgcttcaatctggccattactattgctacgtgcgcaacagtaacaac
atctggtatcgcatggatgacgctcgagtgtcgacggccagtcaacaggaagtgatgcgc
caacaagcttacatcctcttttacacgcggattgccaatccgcgaccatcggcacccgtt
gtcgcaaaagctgacgcccaagccaagcccaaggccaccgagcccaagccaaaagcaacc
ccacccctagcatctgaccccatcaccagcgaggaagatggtcgtccacaggcaaaacgc
gtggcacgcgaggccgctgagactgtcccggacaaggcgacacttgtcggcctttcttct
ctacctcgggccgcccaaccagacagtgacgacagtgacgacgacatggcgaatgcagtt
gcaagctccggtgccggctcaaatcccgtagaccccgtgctcatggccacacataccgag
tggaacattacatacaagattagcgctgcctcggccacgattgatgaaatcagcgaaatc
aatctgtttcaagtcgtcgagcctacaaagtggcatgaggcgaatgcgcgacgcgagcgc
gccaaacagcgtcagcagcgtgtgcggcaggtcattgaacgacaacgccgtttgctggac
cagcgtttgcagctacacggcgatgaggttgactcggatctggaggactcactgagtgag
tcgagcgagtcactcaacgatgccgatgcagatgactgggctgcccatctgctcgacgtt
gcgaaaatcatgggcaatggctccactttgacccagtctgccgccgccattgagagcgat
gagagcgacgatgagtgggtgcctccgggtgagcaggcggcgccatccggctcggaagat
agcatgaccgacagtgcgccagaagaaagtggctcgacccccatgcccgcacaagcaccc
ccctcttacttggaggcagtacgcgccagtctcgggtcggaacttgggcccatgctcgat
gaagagacactggagctgctagcacaggcagaccctgaagtccaggctcagatgaagcag
cctttgcatgaagttttggagcaatcacttgtcgtggtccaagatgccatgcttgagcaa
accctggatgaagacgaacaagtggtctatgacggcaagcttacagttgagacttgtccg
ccacatttgttggcctacgtcaaacagcaagtctcagcagccgctcggcagctcttggaa
gacatttacttgacggatgaggaggagaacgacctggccactggctctgcagcaaactcg
gatagcgacgacgatgaagaatctgacgcgcctgactttgctcccgaatctgagtcgact
cctgcattggacggtgttgacgatcctctcctggcctcggacagcgacgatgacgtcgat
gtggctattgacggcgctcctgttgcctcgaccgccagttctcgcgtgcaagaatatgaa
tatgtgccggacgccggccttcctcgacactcgaatgcgaccctgggttgggatggcaag
cgccgagtcggcgtagcgcaaagcttggctgagaccaatgatggtgttttgagttgggag
ggcgccatgagcagtgcactggatggcgagcagccggcgcagcgcgcagctgtggatgct
gccgatgagctcgagcgtgaggagtatgatgaggattacgatcgaggccgtgttaagaag
gtcaaaactggcaagaagactggaccggtggatttgagccagcagctgcagcattcacac
aaccgtcttaaaaacctgaagggcttgaacctcaccaagggtctacgaaatgatcgtggt
cgcggcggtggtcgtggcggaggtcgtggtggacgtggtggacgtgggggtcgtggtgga
cgtggtggtgggcgtggtggtggacgtggccgcggtggtcgcggcggtcgtggcggtcgt
ggcggtggtcgccgttag

DBGET integrated database retrieval system