KEGG   Monosiga brevicollis: MONBRDRAFT_33347Help
Entry
MONBRDRAFT_33347  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
mbr  Monosiga brevicollis
Brite
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MONBRDRAFT_33347
Peptidases [BR:mbr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MONBRDRAFT_33347
Transcription machinery [BR:mbr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     MONBRDRAFT_33347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 594 aa AA seqDB search
MARQVSVASAGDAGLLGPAGIPQHGCVHASDYKTVHDDRKAPGRELFARALSYTWLHSRS
QHTCTACSDLDAHHVEPAFNGQRDLHLCLSCVFIGCFTFSQPNGEPPARHSHEHAVQASH
ALSLSLAHRRVYCHFCNDFIYDPDFEHWIDTHTVMEMEDPHAADPERFAKQPWSLDINTD
AGLQAAESLQARAVLSTRYTPGLGLRGLCNLGNTCFVNSILQALIHNPLLRNFFLADMHR
QSPRCLRLHEPQDFNIGSRIEARSSDGSFQPATIRGVNPDNSYAVEWDDGSVQEVMPRKS
IRSMADATTVPCLACVLAQLFSDAYNGQHEQMSTHTLLYAIWKASSHLAGYSQQDSHEFF
ISLLDGLHQHMVQEGVNPHSNAHDCDCIIHRVFTGKLQSDVSCQSCGFVSTTFEPFWDLS
LGIRRAATGDGQSEQLGEDAMVTCTNCKAKQQAHKRLTLHSLPVALCFHLKRFRQASFTA
PIVKDQVYVRFSQELDLYPYLAHAIATTKDEQGASRPSLRDDAFTYNLFAVITHIGTMQQ
GHYIAHVKHGGQWYCCDDGNVFMVHERDVLQTQAYMLFYIKTRLEYGTPSKDGP
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggcaagtctcagtggccagtgccggagacgcaggcctgcttgggccagctggc
attccacagcatggctgcgtgcatgcctccgactacaagactgttcacgatgatcgcaaa
gcaccgggtcgcgagctctttgctcgtgctctttcctacacctggctgcatagtcgcagc
cagcacacctgcaccgcctgcagtgaccttgatgcgcatcacgttgagcctgccttcaat
ggccagcgtgatctgcatctctgcctctcttgcgtatttatcggctgcttcaccttttca
cagccgaatggcgagcctccagcacgccacagtcatgaacacgccgttcaggccagccat
gctctctccctcagcctcgcacatcgccgcgtgtactgccacttttgcaacgatttcatt
tacgaccctgattttgagcattggattgacacccataccgtaatggagatggaagatccc
catgctgccgacccagaacgttttgccaaacagccttggagcctggatatcaacactgac
gccggtctgcaggcggccgagagcctgcaagcccgagccgtgctcagtactcgctatacg
ccaggcctcggactgcgtgggctgtgcaatctcggcaacacgtgctttgtcaatagcatc
ctgcaggccctgattcacaatcctttgctacgaaacttctttcttgctgacatgcatcga
caatcacccagatgcttgcgccttcatgaaccccaagatttcaatatcggctcacgaatt
gaagcacgcagcagcgatggcagttttcagccggcgaccattcgtggagtgaatcccgac
aattcgtacgccgttgaatgggacgatggctccgtacaagaggtcatgccgcgcaagagc
attcgctccatggccgatgcgacgacagtaccctgcctggcatgtgtgttggcccaattg
ttcagcgatgcctacaacggccagcatgaacaaatgagcacgcatacccttttgtatgcc
atctggaaggcgtcatcacacctcgcaggctacagtcaacaggactcacacgagtttttc
atctccctgctcgatgggctgcatcagcacatggtccaggagggcgtgaatccacacagt
aatgcacacgactgtgattgcatcatccatcgcgtctttactgggaaactacagtcggac
gtgagctgccaaagctgcggctttgtgagcaccacttttgaacctttctgggatctctcc
ctcggcattcggcgcgctgcaactggagatggacagtcggagcagctgggcgaagatgcc
atggtgacgtgtaccaactgcaaggctaagcagcaagcacacaaacggttgactttgcat
tcgttgccggtggccttgtgctttcacctgaaacgcttccgtcaagcttccttcacggca
ccaattgttaaggaccaggtctatgttcgcttttcgcaagaactcgacttgtatccgtat
ctagctcacgccattgcaacaaccaaagacgagcaaggggcatcgcgcccgtctttgcgc
gatgatgcctttacctacaatctctttgcagttattactcatattggtaccatgcaacag
ggtcattacattgcccacgtcaagcatggaggtcaatggtactgctgcgacgacggaaac
gtgtttatggtgcacgagcgggatgtcttacaaacccaggcgtacatgcttttttacatc
aagactcgtctcgagtatggtactccttcgaaggatggaccgtga

DBGET integrated database retrieval system