KEGG   Monosiga brevicollis: MONBRDRAFT_33466Help
Entry
MONBRDRAFT_33466  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MONBRDRAFT_33466
Enzymes [BR:mbr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     MONBRDRAFT_33466
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 5893251
NCBI-ProteinID: XP_001747992
JGI: 33466
UniProt: A9V5J1
AA seq 321 aa AA seqDB search
MAATTLWERLCSMDIKLLGVTGIVAAGAGVLVGLPFGAGALLVGLGAAYYFGHRSPPIAL
NPDQKIPFALIEKEVLSHDTTRFRFALQSPEHVLGLPVGKHMNFSCKVDGKLVVRSYTPV
SSNDEIGYFDMVIKVYKPLPPRFPDGGKMSQYFDQMKIGDTIDVRGPAGHIEYARPGVII
LHKDKKSAPIVKNVTKFAMIAGGTGITPCLQIIRAIKKNPADRTEVYLVFANKSEDDILL
RKELDEVAEDPRFHIWYTIDKAGPGWKYSEGYIDEAMLREHLPPVGEDVQALMCGPPPML
KFACVPNLEKLGYRSDQMATF
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgacgaccctgtgggaacgtttgtgcagcatggatatcaagctgctcggcgta
acgggcatcgtcgccgccggcgccggtgttctggtgggcctgccctttggtgccggtgcc
cttttggtcggcctgggcgcagcctactattttggccaccgctctccccctattgccctc
aacccggaccaaaagattccctttgccctcattgagaaggaggtgttgagccacgacacg
actcgcttccgttttgcgctccaatcccccgaacatgtgcttggcctgcccgtcggcaag
cacatgaacttttcttgcaaggtcgatggcaagctcgtggtccgctcctacactcccgtt
tcctccaacgatgagattggctactttgacatggtcatcaaggtctacaaacccctcccc
cctcgcttccccgatggcggcaaaatgagccagtactttgatcagatgaagattggtgat
accatcgacgtgcgtggcccggctggccacattgagtatgcccgccctggcgtcattatc
ctccacaaggacaagaagtcggcaccaatcgtcaagaacgtcaccaagtttgccatgatc
gcgggtggcaccggcatcaccccttgcctccagatcatccgtgccatcaagaagaaccct
gctgaccgtaccgaggtctacctcgtctttgccaacaagtcggaggatgacattttgctg
cgcaaggagctggatgaagtggctgaagatccccgcttccacatctggtacaccattgat
aaggccggtcctggctggaagtacagtgagggctacatcgatgaagccatgctccgcgag
cacttgccccctgtcggcgaggatgtacaggctttgatgtgcggtccccccccaatgctc
aagtttgcctgtgtgcccaacctggagaagcttggctaccgcagcgaccagatggcaacc
ttttag

DBGET integrated database retrieval system