KEGG   Monosiga brevicollis: MONBRDRAFT_33466Help
Entry
MONBRDRAFT_33466  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mbr  Monosiga brevicollis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mbr00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 321 aa AA seqDB search
MAATTLWERLCSMDIKLLGVTGIVAAGAGVLVGLPFGAGALLVGLGAAYYFGHRSPPIAL
NPDQKIPFALIEKEVLSHDTTRFRFALQSPEHVLGLPVGKHMNFSCKVDGKLVVRSYTPV
SSNDEIGYFDMVIKVYKPLPPRFPDGGKMSQYFDQMKIGDTIDVRGPAGHIEYARPGVII
LHKDKKSAPIVKNVTKFAMIAGGTGITPCLQIIRAIKKNPADRTEVYLVFANKSEDDILL
RKELDEVAEDPRFHIWYTIDKAGPGWKYSEGYIDEAMLREHLPPVGEDVQALMCGPPPML
KFACVPNLEKLGYRSDQMATF
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgacgaccctgtgggaacgtttgtgcagcatggatatcaagctgctcggcgta
acgggcatcgtcgccgccggcgccggtgttctggtgggcctgccctttggtgccggtgcc
cttttggtcggcctgggcgcagcctactattttggccaccgctctccccctattgccctc
aacccggaccaaaagattccctttgccctcattgagaaggaggtgttgagccacgacacg
actcgcttccgttttgcgctccaatcccccgaacatgtgcttggcctgcccgtcggcaag
cacatgaacttttcttgcaaggtcgatggcaagctcgtggtccgctcctacactcccgtt
tcctccaacgatgagattggctactttgacatggtcatcaaggtctacaaacccctcccc
cctcgcttccccgatggcggcaaaatgagccagtactttgatcagatgaagattggtgat
accatcgacgtgcgtggcccggctggccacattgagtatgcccgccctggcgtcattatc
ctccacaaggacaagaagtcggcaccaatcgtcaagaacgtcaccaagtttgccatgatc
gcgggtggcaccggcatcaccccttgcctccagatcatccgtgccatcaagaagaaccct
gctgaccgtaccgaggtctacctcgtctttgccaacaagtcggaggatgacattttgctg
cgcaaggagctggatgaagtggctgaagatccccgcttccacatctggtacaccattgat
aaggccggtcctggctggaagtacagtgagggctacatcgatgaagccatgctccgcgag
cacttgccccctgtcggcgaggatgtacaggctttgatgtgcggtccccccccaatgctc
aagtttgcctgtgtgcccaacctggagaagcttggctaccgcagcgaccagatggcaacc
ttttag

DBGET integrated database retrieval system