KEGG   Monosiga brevicollis: MONBRDRAFT_33671Help
Entry
MONBRDRAFT_33671  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
mbr  Monosiga brevicollis
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mbr00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 569 aa AA seqDB search
MASATTTSPTAAPTAAPAAADEAPLLQDEFEHHGQTVSVVLTRTAIELRSTSRPGSSGRL
PLEEVYGTAIVERNAQRFGLELFRLHAKKEGGKAKQLRVRDRFCSSDPSPLRARHPPEPV
PHICVLQSLLESTDRTKLENWSTVIRRHAACQQENGHPRHLLVLVNPYGGTKRAPKIYTR
HVKPMLDRAGIRHTMRHTEHACHAIEIGATLDLALYTGIVVVSGDGLLNEMINGLLHRDD
WEAAAQIPIGIIPAGSGNGLAWCLGHFQVEKAVFHLIKGHTTPLDIFRAWQGPKVHYGFL
CLHHGLIADVDIESEQYRWAGAARFTLSGVRRLLGLRRYPTRVWYQPAAAYDENRLPATA
RTLPEDDVDAANAAANPKIRSRCPVSQLERYPASARLPDDPASHGWKLFDGESSIALALN
APWTALLRHGSTLCNTSSRRFTPPNHTALIMWRGGSWCICFRLHKRLIGPFLEPEKAAHI
GKPWTRYVLVKNAIFEFADDRGVLNMDGEVLPHVTTAMDMMPSVMRIYSMQDVPLPAEDP
ANVPPGGMFCEPDELTPARADQARSVGSC
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgccacgacgacatcgccaacggcagcgcccacggcagcgccagcggcagca
gatgaggcgcctttgctgcaagatgagtttgagcaccacggccagaccgtctctgtcgtg
ctgacacgtactgccatcgagctgcgctccaccagtcggcctggatcctccggtcgcctg
ccgctggaggaggtgtatggaactgccatcgtcgagcgcaatgcacagcgctttggcctc
gagctgtttcgcctgcacgccaagaaggaaggcggcaaggccaagcaattacgggtgcga
gatcgcttctgctcgtccgacccgtctcctctgcgcgcgcgccaccctccagaaccagtg
cctcacatctgcgtgctacagagcctgctcgaatccaccgatcgcaccaagctggaaaat
tggtccaccgtcattcgtcgccatgccgcttgccagcaagagaatggccatccccggcac
ctcttggtcctcgtcaacccctatggtggcaccaagcgagcccccaaaatctatacccgc
cacgtcaagcccatgctcgatcgtgccggcatccgtcacacgatgcgccacaccgagcat
gcttgccatgccatcgaaattggagcaacgctcgacctcgccttgtatacgggcattgtg
gtcgtcagtggcgatggcttgctcaatgaaatgatcaacggcctgcttcaccgcgacgac
tgggaggctgccgctcaaattccaatcggcatcattcctgctggttctggcaatgggttg
gcctggtgcttgggccacttccaggtcgaaaaggccgtatttcacctgatcaagggccac
accacgccgctcgacatcttccgtgcctggcaagggccaaaagtacactacggttttctc
tgccttcaccacggcctgattgctgacgttgacattgaatctgaacaatatcgatgggct
ggcgctgcccgatttaccctttctggtgttcgtcgcctgttgggccttcgccgctacccg
actcgcgtctggtatcaacctgccgcagcctacgatgagaaccgcctgcctgccactgca
cgcaccttgcccgaggatgacgtggacgccgcaaatgccgccgccaaccccaagatccga
tcacgctgcccggtttcacagctggagcgctatcctgcatcagcacggctgcccgacgat
cccgccagccacggttggaagttgtttgatggcgagagctcaatagctctggcactcaac
gcgccctggacggctctgctacgccacggcagtacgttgtgcaatacaagcagccgtcgt
tttacaccgccaaaccacaccgcgctcataatgtggcggggaggctcatggtgcatttgt
ttccgtttgcacaaaagactcattggccctttcctggagccagaaaaggcagcgcacatt
ggaaaaccatggacacgctacgtcctggtcaagaatgccatctttgaatttgccgatgac
cgcggcgttttgaacatggatggcgaggttttgccacatgtcacgacggccatggacatg
atgcccagtgtgatgcggatctactcaatgcaagatgtgccactgcctgctgaggatcca
gccaacgtgcctcccggcggcatgttctgtgaacctgatgagctgacgccagctcgtgca
gaccaagctcgatcggttggctcctgttag

DBGET integrated database retrieval system