KEGG   Monosiga brevicollis: MONBRDRAFT_33671Help
Entry
MONBRDRAFT_33671  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
mbr  Monosiga brevicollis
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    MONBRDRAFT_33671
Enzymes [BR:mbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     MONBRDRAFT_33671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 569 aa AA seqDB search
MASATTTSPTAAPTAAPAAADEAPLLQDEFEHHGQTVSVVLTRTAIELRSTSRPGSSGRL
PLEEVYGTAIVERNAQRFGLELFRLHAKKEGGKAKQLRVRDRFCSSDPSPLRARHPPEPV
PHICVLQSLLESTDRTKLENWSTVIRRHAACQQENGHPRHLLVLVNPYGGTKRAPKIYTR
HVKPMLDRAGIRHTMRHTEHACHAIEIGATLDLALYTGIVVVSGDGLLNEMINGLLHRDD
WEAAAQIPIGIIPAGSGNGLAWCLGHFQVEKAVFHLIKGHTTPLDIFRAWQGPKVHYGFL
CLHHGLIADVDIESEQYRWAGAARFTLSGVRRLLGLRRYPTRVWYQPAAAYDENRLPATA
RTLPEDDVDAANAAANPKIRSRCPVSQLERYPASARLPDDPASHGWKLFDGESSIALALN
APWTALLRHGSTLCNTSSRRFTPPNHTALIMWRGGSWCICFRLHKRLIGPFLEPEKAAHI
GKPWTRYVLVKNAIFEFADDRGVLNMDGEVLPHVTTAMDMMPSVMRIYSMQDVPLPAEDP
ANVPPGGMFCEPDELTPARADQARSVGSC
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgccacgacgacatcgccaacggcagcgcccacggcagcgccagcggcagca
gatgaggcgcctttgctgcaagatgagtttgagcaccacggccagaccgtctctgtcgtg
ctgacacgtactgccatcgagctgcgctccaccagtcggcctggatcctccggtcgcctg
ccgctggaggaggtgtatggaactgccatcgtcgagcgcaatgcacagcgctttggcctc
gagctgtttcgcctgcacgccaagaaggaaggcggcaaggccaagcaattacgggtgcga
gatcgcttctgctcgtccgacccgtctcctctgcgcgcgcgccaccctccagaaccagtg
cctcacatctgcgtgctacagagcctgctcgaatccaccgatcgcaccaagctggaaaat
tggtccaccgtcattcgtcgccatgccgcttgccagcaagagaatggccatccccggcac
ctcttggtcctcgtcaacccctatggtggcaccaagcgagcccccaaaatctatacccgc
cacgtcaagcccatgctcgatcgtgccggcatccgtcacacgatgcgccacaccgagcat
gcttgccatgccatcgaaattggagcaacgctcgacctcgccttgtatacgggcattgtg
gtcgtcagtggcgatggcttgctcaatgaaatgatcaacggcctgcttcaccgcgacgac
tgggaggctgccgctcaaattccaatcggcatcattcctgctggttctggcaatgggttg
gcctggtgcttgggccacttccaggtcgaaaaggccgtatttcacctgatcaagggccac
accacgccgctcgacatcttccgtgcctggcaagggccaaaagtacactacggttttctc
tgccttcaccacggcctgattgctgacgttgacattgaatctgaacaatatcgatgggct
ggcgctgcccgatttaccctttctggtgttcgtcgcctgttgggccttcgccgctacccg
actcgcgtctggtatcaacctgccgcagcctacgatgagaaccgcctgcctgccactgca
cgcaccttgcccgaggatgacgtggacgccgcaaatgccgccgccaaccccaagatccga
tcacgctgcccggtttcacagctggagcgctatcctgcatcagcacggctgcccgacgat
cccgccagccacggttggaagttgtttgatggcgagagctcaatagctctggcactcaac
gcgccctggacggctctgctacgccacggcagtacgttgtgcaatacaagcagccgtcgt
tttacaccgccaaaccacaccgcgctcataatgtggcggggaggctcatggtgcatttgt
ttccgtttgcacaaaagactcattggccctttcctggagccagaaaaggcagcgcacatt
ggaaaaccatggacacgctacgtcctggtcaagaatgccatctttgaatttgccgatgac
cgcggcgttttgaacatggatggcgaggttttgccacatgtcacgacggccatggacatg
atgcccagtgtgatgcggatctactcaatgcaagatgtgccactgcctgctgaggatcca
gccaacgtgcctcccggcggcatgttctgtgaacctgatgagctgacgccagctcgtgca
gaccaagctcgatcggttggctcctgttag

DBGET integrated database retrieval system