KEGG   Monosiga brevicollis: MONBRDRAFT_33999Help
Entry
MONBRDRAFT_33999  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mbr  Monosiga brevicollis
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:mbr03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 321 aa AA seqDB search
MADLDLDVAGIIDRLLEVRGCRPGKTVSLEEREISGLCLSAREAFLAEPMLLRLQAPVKI
CGDVHGQYYDVLRLFEHSGFPPASSYLFLGDYVDRGKQSLETICLLLAYKVLYPDKIWLL
RGNHECASINRIYGFYDECKRRYSIKLWKTFTDCFNCLPVAAVVADKIFCCHGGLSPDLQ
ALDQITNVQRPTDVPDTGLLCDLLWSDPEREVENWAENDRGVSFTFGADIVEKFLLQHDL
DLICRAHQVVEDGYEFFAQRQLVTVFSAPNYCGEFDNAGAIMTVDANLMCSFQILKPADK
KSKYRYASDPGAAERDVLPVA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcggatctggatctggacgtcgcgggcatcatcgaccgactcctcgaagtccggggc
tgtcggccgggaaagacagtgagcctcgaggagcgcgagatctccgggctctgcttgtcg
gcgcgcgaggcctttctggccgagcccatgctcttgcgcctccaggccccagtcaaaatc
tgtggtgatgtgcacgggcagtactatgacgttctgaggctctttgagcacagtggcttc
ccgcccgccagcagttatctgttccttggcgactacgttgatcgtggcaaacagtccttg
gagaccatctgcctgctgctggcctacaaggtcctttacccggacaagatctggctcttg
cgtggcaaccacgaatgtgccagcatcaaccgcatctatggcttttacgatgagtgcaag
cgtcgctactccatcaagctttggaaaaccttcaccgactgcttcaactgcctgcccgtt
gctgccgttgttgctgacaagatcttctgctgccatggtggcctctcacccgacttgcaa
gctctcgatcagatcacgaacgtgcaacgaccaaccgacgtgccagacactggcctgctc
tgcgatctgctgtggagcgatcccgagcgcgaggttgagaattgggccgaaaacgatcgg
ggcgtttcattcacgtttggcgccgacattgtggaaaagtttttattacagcatgacctg
gatcttatttgccgcgctcatcaggtggttgaggatggctacgaattcttcgcacaacgt
cagctagtgactgtcttcagcgcaccaaactactgcggtgaatttgacaacgcgggtgcc
atcatgaccgttgatgccaacctcatgtgctcctttcaaatcctcaagcccgctgacaag
aagtcaaagtatcgctatgcctccgacccaggcgcagcagagcgtgatgttttgcctgtg
gcgtaa

DBGET integrated database retrieval system