KEGG   Monosiga brevicollis: MONBRDRAFT_34009Help
Entry
MONBRDRAFT_34009  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
mbr  Monosiga brevicollis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MONBRDRAFT_34009
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1955 aa AA seqDB search
MWAFARQLLADIEAAAYSTDERQLHRLKAAFEDAVPEFYYLQSPKDKDRDGGASETLVFH
TLPNSSDQQAVDQARTKPLAIFKARVEGAATTTILTDQQVANAHTLSGILGISQVTAAAL
LVEAEDITNHPLVFREASLLTRGAFLFYEAERMLFSILCILLEAVTKQSFSPNFNTLALE
LLESLQELPAIVLTAVLALHRSDFEARADAAQLLAHDRSAARLLQEVKDCWLEACDALLL
FVTAARVVAQRQPSDSNVDTITTQECLILLKTLQQTLGDGPAGSALAPTNTHASHTTAAL
DGTRVFVAPTAVICLLHVFLRRRLHAVAALRTGDRTSDYNDPLANDLDFARALDDTTAWN
NNPTWRLLMQLAFGLCRTALDKPEDVWEGVQQQATTLIDHRSDESVFECLHQLANAPQCG
AEDKSSAISIDTLLAFCDWLIEDGGLLRMLMYNYTEAVASGSDVTHDDFVWLLKTIATVA
QRADADMMAERVSVWDGFLRMVGDQLDATTYIVYLEVLAAFAKPGPASQYVFTLLMDNGR
EGFRQAPVSWRSLFAAIASATSMSHESGQAVDILTQQMLEAFLHLLATVCEDPECARGIV
SRDDWHAIDTLFTFFCSHLETTLKGKLLAALAAICAAHPPAARVVWHLICASHVLVGDST
NMGNIQIRDLGVVHDLRKREAEAKTYPETFNFVRLLKAVLPHVVDEPQSRHSLRVAINYL
ISEVFLAALRSLQFISETERWELLADALTTLRELLSRYQPTEGDFGGAIPAGATPAEAFT
NVAGSGLDMTADDEGEVQRFDDHRHVQGPRYVGFLVLASLLQDPTGNVLVGLGNILARSA
PHEWVDKPVQLQEAVINCVTLTVQILEVAAGFSAALNDMHVKTHQRVDSFLMNQSRGDDV
LSPLVVHLIMLLDAEHSAELALDAIKLVYRIAGTSHNNVSLRSIFNAAPALERQKMLFAF
QYRLMAIGPELVSDQQDVYVDVLDEEHYSCDNAVASSVVQLLRYSLSEDGLWEITPLLLM
IGVAARITKPRDVMQVQLLPSQAADAQSCLHVLIDLITNKSAANRLPLYQLHPLFAENCF
ALLYALQSHPVVGPMVVRFTRESSLARDLLEQLKGLLELSTFSTELDRRSAAWTSTMGWI
LKSIALELYVAAKEPSEEQRWLYKELFGLPQQSAVFSDTFVGDAAAQPVSLMRRVLNAID
FRLETVGQLNLSHLPLGIANQAFQACTKTQVTLGDEPIPYCFVREMHEQLLGMLERGGYD
LGLREAYVDDITAAVNVALQTNLIAERRGARLHLLKGWERVLTIMFSKTAPLVTGDDQIA
ELGEQLMYLLTHLPVDLQMTQQLDPALMSVLSNNIVTLTANLQGSLQRMSGIEEAQSSAL
SVVRNLQEPLLASLVQGVLTAGCGPRMRQNHYCSLHFYITIARTAESSLPSDWIAGPSER
FMDMVCRDACDGTGVTCILALLALSELVALDDKGNWLAFMARRGFLDQYVHEAQAAEEQL
QALAFQSSSNFNPFYKHQARYALFLNCARSSSGAKALLESPLLLQLEHSKLLRAHNVSDD
GSVGSSGASWSNVDPRSIVLPMLRVLDQMTMHAAGTDIHLGMARVFRANFTAYFRPVLKG
WSALKTPNALDELMLVTSLVRKLIARAAKLDPECFDQEEVQRLIIPLLAYLMRADWKAAI
HYNSREAFEQNEIMVLVQNTLFNILCFLRQSLDRDVEVGKRVHVALAARVFIKPSFVEDV
ADEITCGSALSLLKQLLATQQDAKKEQLNARSSEGSISMLGPDRLRRIGVAEDDAKNEQV
VARALELMADTSEQIVRITQSSTECLLYMLWRHLDFYLNSQRAHQTSTFQPQRKIRTLEA
GIVGAPLHHNSDMSDMREDPSLSAPHALTTEELKVFQDEVQKVSALRSNADSLLSKLVAR
EKELLVEQKFQHGVALTLIKPIERRIRSLVDGLNA
NT seq 5868 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcctttgcccgtcagctgctggcggacattgaggcggcagcctattcaaccgac
gagcgccaattgcaccggctcaaggccgcctttgaggatgccgtgccggaattctactat
cttcagtcccccaaggacaaggaccgcgatggtggtgccagtgagaccctggtcttccac
accctgcccaacagtagcgatcagcaagccgtagaccaggcacgcaccaaacccctggcc
atcttcaaggcccgggtggagggcgccgccacaaccaccatcctcaccgaccagcaggtg
gccaatgcccacaccctgagtggaatcctcggtatcagccaagtcactgcggccgctttg
cttgtcgaggccgaagacattaccaaccatcccctcgtctttcgcgaagcctccctgctc
acccggggtgcctttctcttctacgaagctgaacgcatgctcttcagcatcctctgcatc
ctcctcgaggctgtgaccaagcagtccttcagccccaactttaacactttggcccttgag
ctcctcgaaagccttcaggaactcccagccatcgttctcacagcagtcctggcccttcac
cgtagtgactttgaggcccgtgccgatgcagctcaactcctggcccacgaccgcagtgcc
gctcgccttcttcaggaagtcaaggattgctggcttgaagcctgcgacgcccttttgctt
tttgtcaccgcggctcgagtcgtcgcccaacgtcaaccaagtgactccaacgtagacacc
atcaccactcaggaatgcctcatcctcctcaaaaccctccagcaaaccctcggtgatggc
cccgcagggtccgcgctcgcaccaaccaacacgcacgccagccatactacggccgccctg
gacggaacccgcgttttcgtagccccaacagctgtcatctgtctcctgcacgtcttcctt
cgccgccgtctccacgccgttgccgctctccgcaccggtgaccggaccagcgactacaac
gacccgttggccaatgaccttgactttgcccgcgccctggacgacaccactgcctggaac
aacaaccccacctggcgcctcctcatgcagctggcatttggtctctgccggactgccctc
gacaagccggaggacgtctgggagggcgttcagcaacaggccaccacccttatcgaccac
cgtagtgatgaatccgtctttgagtgcctgcaccagctggccaacgcaccccagtgtggg
gccgaggacaagtcgagcgccattagtatcgacaccctccttgccttttgcgactggctc
attgaagatggtggccttcttcgcatgctcatgtacaattacaccgaggccgtggctagc
ggatcagacgtcacccacgacgactttgtttggctcctcaagaccattgccaccgtggcc
cagcgcgctgatgcagacatgatggcggaacgagtctccgtgtgggatggcttcttgcgc
atggttggcgaccaactcgatgccaccacctacatcgtctatcttgaggtcctggccgcc
tttgccaagcctggccccgcgagccagtacgtcttcaccctcctcatggacaatggtcgt
gaaggcttccgccaagcccccgtctcgtggcgctccctctttgccgccatcgcctcagcc
accagcatgtcacacgaatctggtcaagctgttgacattctcacgcaacaaatgctcgag
gcctttttgcacctcctcgccactgtctgcgaggatccagaatgcgcccgcggcattgtt
agccgagacgactggcacgccatcgacaccctcttcactttcttctgctcccacttggag
accacgctcaagggcaaattgctggctgctttggccgccatctgcgccgctcatcccccg
gcggcccgcgtcgtttggcacctcatctgtgcgagccacgttttggtgggtgactccaca
aacatgggcaatatccaaattcgggacctcggtgtcgtgcatgaccttcgaaagcgcgaa
gcagaagccaagacttaccccgagaccttcaactttgtgcgcctcctcaaagccgtcctc
ccccacgtggttgatgaacctcagagtcgccacagcctccgcgtcgccatcaactacctc
atttccgaggtcttcttggcagcccttcgtagcctacaattcatcagcgaaacggagcgc
tgggaacttttggccgatgctctcaccactctgcgcgagctcctgtcgcgctatcagccc
actgagggcgactttggcggtgcgattccggcaggagccacccctgcggaagccttcacg
aacgtagccggttctggattggacatgactgcggacgatgaaggggaagtacaacgtttt
gacgaccaccgccacgtccaaggcccgcgttacgtcggctttctggttctggccagcctt
ttgcaagaccccaccggcaacgtgctcgttggtctgggcaacattttggcgcgctcggcc
ccacatgaatgggtggacaagccagtacagctccaggaggccgtcatcaactgtgttacc
ctcacggttcagattctcgaggtggctgcaggcttcagcgctgccctcaatgacatgcac
gtcaagacgcaccaacgcgtagactccttccttatgaaccaatcacgaggcgacgacgtg
ctctcgcccctcgttgttcatctcatcatgcttctcgatgccgagcactcggccgaactg
gcactcgatgccatcaagttggtgtatcgaattgccggcacatcgcacaacaatgtatct
ctgcgctcaatcttcaacgctgcccctgcgctggaacgccagaaaatgctcttcgccttc
cagtatcgcctcatggccatcggccccgagctagtgtcggaccaacaagacgtctatgtg
gacgtgcttgacgaggaacactactcgtgcgataatgctgtggcctccagcgtggtacag
ctccttcgctacagcctcagcgaagacgggctttgggagatcacgcccctcctgcttatg
attggtgtcgccgctcgcatcaccaagcctcgggacgtgatgcaggtgcagctgctgccc
agccaagctgccgacgcacagtcctgtctgcacgttctcattgacctcatcaccaacaag
agcgccgccaaccgcctccccctgtaccagcttcacccgcttttcgcagagaattgcttt
gctttgctctacgctctgcagtcccatccggtggtcggcccaatggttgtccgctttacg
cgcgagtcgtccctggcccgagatctgctcgaacagctcaagggtttactcgaactgagt
acctttagtacggagctggaccgccgcagcgcggcttggaccagcaccatggggtggatc
ctcaaatccatcgccctcgaactctacgtggctgcgaaggagccctccgaggagcagcgc
tggttgtataaggagctgtttggccttccgcagcagtcggccgttttctccgacacattt
gtgggtgatgctgccgcccagcccgtgagcctgatgcgccgcgtgctcaacgccattgac
tttcgtctcgagacagtgggccagctgaatctctcgcatctgccccttggcattgccaat
caagcttttcaggcctgtaccaagacccaagtgactttgggcgacgagcccattccatac
tgctttgtgcgtgagatgcatgagcagctgctgggaatgttggagcgcgggggctatgac
ctgggcctgcgcgaggcctatgtggatgacatcacggccgcagtcaacgtggcgctccag
accaatctcattgccgagcgacgtggcgcgcggctccatctgctcaagggctgggaacgc
gtgctcaccatcatgttcagcaaaaccgccccgctggtgacgggagacgaccaaatcgcc
gagcttggcgaacaactcatgtacttgctcacccacctgccagttgacctgcagatgacg
cagcagttggacccggcgctcatgtctgttctgtccaacaatattgtgaccctgacagcc
aacctgcaggggagcctccagcgtatgagtggcattgaggaagcacagagcagtgctctg
agtgttgttcgtaacctgcaagaacccctcctggccagccttgttcagggtgtcctgacc
gcaggatgtggcccacggatgcgccagaaccattactgtagccttcacttttacattacg
attgcacgcacggctgaatcatctctgccttcggactggattgcgggacccagtgaacgc
ttcatggacatggtctgccgcgatgcttgcgatggaactggcgtgacctgtatcctggcc
cttctcgccctttcagagctggtggctttggacgataagggcaactggctggcattcatg
gctcggcgcggctttttggaccagtacgttcatgaagcacaggctgctgaagaacagctt
caagcgctcgcgttccagtctagctccaactttaacccgttttataagcatcaggcgcgt
tatgccctttttctcaattgcgcccgctcctcaagcggtgccaaggccttgctcgagtca
cctctgctcttgcagcttgagcatagcaagctcttgcgtgcccacaacgtgtccgatgat
gggtccgtcggcagcagtggcgcgagctggagcaatgtcgatcctcgcagcattgtattg
cccatgcttcgcgtcctcgatcaaatgaccatgcatgcggctggcacggacattcacctg
ggcatggctcgcgtcttccgagccaactttaccgcctactttaggccggtcctgaagggt
tggagtgccctcaagacgccgaatgcgctggacgagctcatgttggttacctccttggtg
cgcaaactgattgcacgcgctgccaagctcgatccggagtgcttcgatcaggaagaggtg
cagcgcttgatcattccacttttggcctatctcatgcgtgccgactggaaagcagccatt
cattacaactccagagaagcgtttgagcagaacgagattatggtgctggtccagaatact
ttgttcaacattctctgcttcctgcgccagtcacttgatcgtgacgtagaagtgggcaag
cgtgtccacgtggccttggcagcccgggtctttatcaaaccctcctttgtggaagacgtg
gctgacgaaatcacgtgtggatcggctttgagcctgctcaagcagcttttggccacccag
caggatgcgaagaaggagcagctcaatgctcgctccagcgaaggctccatctccatgctg
ggtccagaccggttacgccggattggtgtggctgaggacgatgccaaaaacgagcaagtg
gtggcccgagcccttgagttgatggcggacaccagcgagcagattgtccgcatcacccag
tcctcgaccgaatgccttctatacatgctatggcgtcacctcgacttttatctgaacagt
cagcgtgcccatcaaacttccacgttccaacctcagcgaaaaattcgaacgctggaagct
gggattgtgggggcacctcttcatcacaattctgatatgagcgatatgcgtgaggaccct
tcgctctcagcaccgcatgctttgaccaccgaagaactcaaagtcttccaggacgaggta
cagaaggtgtcggctttgcggtccaatgccgatagcttgctgtccaagctcgttgcacga
gaaaaggaattattggtcgaacaaaagtttcagcatggcgttgctttgaccctgatcaag
cccattgagcgacgcattcgctctctggtggatggtttgaatgcctaa

DBGET integrated database retrieval system