KEGG   Monosiga brevicollis: MONBRDRAFT_34173Help
Entry
MONBRDRAFT_34173  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
mbr  Monosiga brevicollis
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MONBRDRAFT_34173
  Lipid metabolism
   00062 Fatty acid elongation
    MONBRDRAFT_34173
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     MONBRDRAFT_34173
Lipid biosynthesis proteins [BR:mbr01004]
 Fatty acid synthase
  Component type
   MONBRDRAFT_34173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 323 aa AA seqDB search
MRACSVTMILAAAACCCGFLAPSVRAEDSAYPPVVIMHGILGTAENLETVAEWIREQLPG
IYVKSMEVGNGALDSVFMDMNKQVELFCENIYADEKLKDGFNLIGFSQGGLVSRGYLQRC
NKYPVINFISWASPQGGQFGGVEALVPPVVSVIFGRAPYSPLMQSGLALAQYWRDPYALD
LYRSNSSFLADLNNERPEKNETYKKHITSLKSMMLLHSTVDEVISPPTSGWFETFLPFTG
PGEKGVVVPLRQSLLYLQDWIGLKVLDKSGRLQMHTSDCAHEDHPNAACKHSFDLYTLPL
ISETWDSVRSWRVKNPMYALNAH
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgtgttcagtgaccatgatactggcggcggcggcctgctgctgcggatttcta
gcgcccagcgtgcgtgctgaggactcggcctacccgcccgtggttatcatgcatggtatt
cttggaacggctgagaatcttgaaacggtggctgagtggattcgcgagcagcttcccggc
atctatgtcaagtcaatggaggttggcaacggtgccctcgactctgtctttatggacatg
aacaagcaggttgaactcttttgtgaaaacatttacgccgatgaaaagctcaaggatggc
ttcaacctcattggcttcagccaaggcggcctcgtgtctcgcggctatctccagcgctgc
aacaagtaccccgtgatcaacttcatctcttgggcctcgccacaaggcggccaatttggt
ggcgtcgaagccctcgtgcccccagtcgtgagcgtcatctttggtcgcgctccatactcc
cctttgatgcagagcggtcttgccctcgcccagtactggcgcgatccctatgccctcgac
ctgtaccgcagcaacagcagcttcctggccgacctcaacaacgagcgtcccgagaagaac
gagacatacaagaaacacatcacctcgctcaagtcaatgatgcttctccactcaaccgtc
gacgaggtcatcagcccccctacctcgggctggtttgagaccttcctccctttcaccggc
cccggcgagaagggcgtggtcgttcctctccgccagtccctcctctaccttcaagactgg
attggtctcaaggtccttgacaagtcgggtcgccttcagatgcacacctctgactgtgcc
catgaagaccatcccaatgccgcttgcaagcacagctttgacctttacaccctccccctc
atctccgagacctgggactctgtccgcagctggcgtgtcaagaaccccatgtatgcgctc
aacgcgcactaa

DBGET integrated database retrieval system