KEGG   Monosiga brevicollis: MONBRDRAFT_34332Help
Entry
MONBRDRAFT_34332  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mbr  Monosiga brevicollis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MONBRDRAFT_34332
Enzymes [BR:mbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MONBRDRAFT_34332
Exosome [BR:mbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MONBRDRAFT_34332
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 567 aa AA seqDB search
MKKTTQCMGQVQPFLSLFLSLSHTHTHGHTDGSTERMGRWSPAIRRLQPQFTLIQAGLNK
TPNTLFRLLKRASNKSRTNSKPLVSVPTKLLRESTVAWSKSTGRFLHNAISVSQAMIDAT
PTGDKYHYQKQCGLPISDYFSGVKMRWLIENVPAVRDALVKEDCLFGTIDTWLIWSLTKG
KSYVTDVTNASRTMLMNVARLQWDKNMLKAFGIPEHALPQIKSSAEVYGHIVRLIYFAPL
YPAPSCVNSEATGPLRGTAIASCLGDQQAALLGQLCLKKGMAKNTYGTGCFLLCNTGTKP
TFSKNGLLTTVAFQLGPNASCMYALEGSVAVAGEGIKWLRDQLGFVKSAADVEALAKEVK
DTDGVYFVPAFSGLLAPYWRGDARGTIVGLSHSSGRAHIARAMLEAVCFQTRELTEAMAR
DAGLTLTQLNVDGGMTANNLLMQMQADLLGVDVVRPDNAESTSWGAAIAAGIADGVGVWH
LESIHEQRSTQRFESTVQDEERDDRYRQWRRAVSRSLGWIQSTSQRDQNKGPAEGKPDMT
ANGVYWGPLLLFLTMTGLTASAAQALH
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaacgacgcagtgcatgggccaagttcaaccatttctctctctctttctctct
ctctctcacacacacacacacggacacacggacgggtctaccgagaggatgggtcggtgg
tcgccagccatcaggaggctacaacctcaatttaccctcattcaggctgggttgaacaag
accccgaacacattgttcagactgttgaaacgtgcatcgaacaagtcgcgcacaaactca
aagccgctggtctcggtgccgaccaaattgctgcgcgagtccaccgtggcctggtccaag
agtactggccgtttcttgcacaacgccatcagtgtgtcccaggccatgatcgatgccacg
cccaccggcgacaagtatcattatcagaaacaatgcggcctgccgatttccgactacttt
agcggggtcaagatgcgctggctgattgaaaacgtgcccgccgtgcgcgacgcactcgtc
aaggaggactgcctctttggaaccattgatacgtggctcatttggtccttgaccaagggc
aagtcatacgtcacggacgtcaccaacgccagccgcaccatgctgatgaacgtcgcacgc
ctacaatgggacaaaaatatgctcaaggcttttggcattcctgagcacgccctgccccaa
atcaaaagcagtgccgaggtctacggtcacattgtacgtttgatctactttgcacctctc
tatcccgccccttcgtgcgtcaacagtgaggccacgggcccgttgcgcggcacggccatt
gccagctgtctgggcgaccagcaggctgccttgcttgggcagctctgcctgaagaagggc
atggccaaaaacacatatggcacgggttgcttcttgctctgcaacacgggcaccaagcct
actttttccaaaaacgggctcttgaccaccgtcgcctttcagctcggccccaacgcctcg
tgcatgtatgccctggagggttcggttgccgtggctggcgagggtatcaaatggttgcgc
gaccagctgggttttgtgaaatcagccgcggacgtcgaggctttggccaaggaggttaag
gatacggatggcgtgtactttgtacctgccttctctggcttacttgctccctactggcgc
ggtgatgcgcgcggtaccattgttgggctcagccattcttctggccgggcgcacattgcc
cgtgccatgctagaagctgtctgcttccagacgcgcgagctgacggaagccatggcgcgg
gatgcgggtttgacgctgacacaattgaacgtggatggtggtatgacggccaacaacctt
ctcatgcagatgcaagccgatttgctgggcgtcgacgtcgttcgacctgacaacgccgag
tccacgtcttggggtgcggccattgcggctggtatcgctgacggagtgggtgtgtggcat
ttggagtctatccatgaacagcgcagcacccagcgctttgaatcgacggtgcaggatgaa
gagcgggacgatcgctaccgccagtggaggcgggccgtctcgcgcagtctgggctggatt
caatctacgagccaacgtgatcaaaacaagggacctgctgagggcaagcccgacatgaca
gcaaatggcgtgtactggggtcctctgctgctcttcttgaccatgacaggtttgacggcc
agtgcggctcaagctctccactaa

DBGET integrated database retrieval system