KEGG   Monosiga brevicollis: MONBRDRAFT_34384Help
Entry
MONBRDRAFT_34384  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
mbr  Monosiga brevicollis
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MONBRDRAFT_34384
Enzymes [BR:mbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     MONBRDRAFT_34384
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     MONBRDRAFT_34384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 368 aa AA seqDB search
MEMLGKTIVEGKTKVVHQHARNFDQVILVSKDRITAGDGARAHEISGKAKVANDTTCTIF
EFLNSVGIPSHFVARSGDMMVAKKVHMIPIECVARRVAYGSYLRRFKTPFPVTEAYRFPT
PCLEFFYKDDANHDPQVTKEQLLSNPLLLDEAKQLRLTPKYVEQMELWTRAVFETLERAW
AVQGCTLVDMKIEFGIDMQGRLILADVIDNDAWRVWPQGDRRLMKDKQFYRELKTVTDAD
LTEVLKKYEWVADAVRGFKARRPTACIAVGVDAPNLKGAQTKLQHYSALTPISLTALQTI
SEPTVVVTSAALFASVASITACPVLIADANTDSAVLREQILRILARDDHVLWCSLHAEQI
AATVAAQN
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggagatgcttggcaagaccatcgtcgagggcaagaccaaggtcgtccaccaacatgcc
cgtaactttgaccaagtgattctcgtgtccaaggaccgcatcacagctggggatggtgcg
cgtgctcatgagatttcgggcaaggccaaggttgccaacgacaccacctgcaccatcttt
gagttcttgaacagcgttggtattcccagccactttgtcgctcgcagcggggacatgatg
gtggccaagaaggtgcacatgatcccgatcgagtgcgtggctcgccgcgttgcctacggc
tcgtaccttcgtcgtttcaagacgccgttccctgtgacggaggcctaccgctttccaacg
ccttgcctcgagttcttctacaaagacgatgccaaccatgacccgcaagtgaccaaggag
cagctcctgagcaaccctcttctgcttgacgaggccaagcagctgcggctgaccccaaag
tacgtggagcagatggagctctggacccgggccgtgttcgaaaccctggaacgcgcttgg
gccgttcaaggctgcaccctcgtcgacatgaagatcgaatttggcattgacatgcaaggc
cgcctcatcttggctgatgtcatcgataacgatgcctggcgcgtgtggccccagggtgat
cgtcgtctgatgaaggacaagcagttttaccgcgagctcaagactgtgacagatgccgac
ttgaccgaggtgcttaaaaaatacgaatgggtcgccgatgctgtgcgcggcttcaaggcc
cgccgccccactgcctgcatcgccgtgggagtggacgccccaaacctgaagggggcccag
accaagctgcagcactactcggccttgactccaatcagtctgaccgcactccaaaccatc
agcgaacccacagtggttgtgacctctgcagcgctgtttgcaagtgtggcatccatcacg
gcctgccccgttctcattgctgatgccaacaccgactcggccgtgttgcgggaacaaatt
ctgcgtattctggcacgcgacgaccacgtgttgtggtgcagcttgcacgcagagcagatc
gccgccacagtggctgcccagaattag

DBGET integrated database retrieval system