KEGG   Monosiga brevicollis: MONBRDRAFT_34892Help
Entry
MONBRDRAFT_34892  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mbr  Monosiga brevicollis
Brite
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     MONBRDRAFT_34892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 462 aa AA seqDB search
MASKKHVSYYYDGDVGNYYYGPGHPMKPHRIRMTHNLLLNYGLYKKMEIYRPHKASMEDM
TRFHSDDYINFLRTISPDATNEETKNMSRFNVGEDCPVFDGLFEFCQISAGGSLAGAAKL
NSQQSDICINWAGGLHHAKRSEASGFCYVNDIVLGILELLKRHERVLYIDIDIHHGDGVE
EAFYCTDRVMTVSFHKYGEYFPGTGDIKDIGTQDGRHYAVNFPLKDHIDDDSYQRIFRQV
IEKVMDWYDPGAVVLQCGADSLTGDRLGCFNLSLKGHAACVEYVKSFNKPLLLLGGGGYT
IRNVARCWTYETSVALDTPIEDELPFNDYFEYFGPDFRLHISPSNHDNQNSEEYLENSVK
QIIENLRHTASRPSVQMHSMVDTLSAYEEDEDQVDPDDRRAQQLVDRKISHDADLSDSED
EGGRRDQQSFKKKKKKKKKKKKKTKTRRVIREEGRPKESIKK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcaagaagcacgtctcgtactactacgatggcgacgtcggcaattactactac
gggcctggccatcccatgaagccccaccgcattcgcatgacccacaatctgcttctcaac
tatggcctctacaagaagatggaaatttaccgcccacacaaggcctcgatggaagacatg
acgcgcttccactcggacgactacatcaactttctccgcaccatcagtcctgatgcaacc
aacgaagagaccaagaacatgtctcgcttcaacgtgggcgaggactgccccgtgtttgat
ggcctctttgaattttgccagattagcgctggtggttcgctcgctggggcagccaagctg
aacagtcagcaatctgacatttgcatcaactgggctggcggtcttcatcatgccaagcga
tccgaagcctctggcttttgctacgtcaacgacatcgtcttgggcatcctcgagctgctc
aagcgtcacgagcgcgtgctgtacattgacattgacatccatcacggtgatggcgtggag
gaggctttctactgcacagaccgcgtcatgaccgtgtccttccacaagtatggcgagtat
ttcccaggcactggtgatatcaaggacattggcacccaggacggccgtcactacgccgtc
aactttcctctcaaggaccacattgacgatgattcgtatcaacgcatcttccgtcaagtc
attgaaaaggtcatggactggtatgaccccggtgccgtcgtgctgcagtgcggcgccgac
tcgttgactggtgaccgtctcggttgcttcaacctatcgctcaaaggacatgccgcttgc
gtggagtatgtcaagtcgttcaacaagcccctgctgctcctgggtggcggtggctacacg
atccgcaacgtcgcccggtgctggacgtacgagacatccgtggctctcgacacaccgatt
gaggatgagctgccattcaacgattactttgagtactttggtcccgacttccgcctccac
atcagcccaagcaaccatgacaaccagaactctgaagagtatcttgagaacagtgtgaag
cagattatcgagaacctgcgccatactgccagtcgtcccagcgtgcaaatgcattcgatg
gttgacacgctcagcgcatacgaagaggacgaagatcaggtggacccggacgatcgccgc
gcacaacagctcgtcgatcgcaagatctcccatgatgcggacctgtccgattcggaggac
gagggcggtcgccgtgatcagcaaagcttcaagaagaagaagaagaagaagaagaagaag
aagaagaagaccaagaccaggagagtcatccgggaggaaggaagaccgaaagaaagcatc
aaaaagtaa

DBGET integrated database retrieval system