KEGG   Monosiga brevicollis: MONBRDRAFT_35258Help
Entry
MONBRDRAFT_35258  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mbr  Monosiga brevicollis
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    MONBRDRAFT_35258
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     MONBRDRAFT_35258
Protein phosphatases and associated proteins [BR:mbr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     MONBRDRAFT_35258
Transcription machinery [BR:mbr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     MONBRDRAFT_35258
Spliceosome [BR:mbr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    MONBRDRAFT_35258
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 307 aa AA seqDB search
MSSVDVDKIISKLLEVRGSRPGKTVDLTEAEIRGLCVKSREIFLNQPILLELEAPLRICG
DTHGQYYDLLRMFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRG
NHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAALIDEKIFCCHGGLSPDLQSM
EQIRRIMRPTDVPDTGLLCDLLWADPEKDSTGWGENDRGVSFTFGPEVVEKFLHKHDMDL
ICRAHQVVEDGYEFFAKRQLVTIFSAPNYCGEFDNAGAMMSVDESLMCSFQILKPADKKT
KYSGFKK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgtcgacgttgacaagatcatctcaaagctgctcgaggtccgcggcagccga
cctggcaagactgttgacctgaccgaggctgagattcgcggtctgtgtgtcaagtcgcgt
gagattttcctcaaccaaccaatcctcctcgagctggaggctcccctccgcatctgcggt
gacacccatggtcaatactacgatttgctgcgcatgtttgagtatggtggcttccccccc
gagtccaactacctcttccttggcgactatgttgaccgtggcaaacagtccctggaaacc
atctgcctcttgctggcctacaagatcaaataccccgagaactttttcctgctgcgtggc
aaccatgagtgcgccagtatcaaccgcatctacggcttttacgatgagtgcaagcgccgt
tacaacatcaagctctggaagaccttcaccgactgcttcaactgcctgcccgttgctgct
ctgattgatgagaagatcttctgctgccatggtggcctttcccccgacctgcagtccatg
gagcagatccgccgtatcatgcgccctaccgacgtgccggacacgggcctcctctgcgat
ctcctctgggctgatcccgagaaggactcaacgggctggggcgagaacgatcgcggtgtc
tcgttcacctttggccccgaggtggttgagaagtttttgcacaagcacgacatggatctc
atctgccgtgcccatcaagtggtggaagacggctacgagttttttgccaagcgtcagctc
gtgaccatcttctctgcaccaaactactgcggtgaatttgacaacgcgggtgccatgatg
agcgttgatgagagcctgatgtgctccttccagattctcaagcccgcggacaagaagacc
aagtactctggcttcaagaagtga

DBGET integrated database retrieval system