KEGG   Monosiga brevicollis: MONBRDRAFT_35273Help
Entry
MONBRDRAFT_35273  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mbr  Monosiga brevicollis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 344 aa AA seqDB search
MAAANSTTGGEGSAMQHISAMANGVHTVHGHIIDVGPRYGHFRFVGEGSYGVVVSAKDSQ
TGQRVAIKKMLLKEHLSFSRRTLREIKILTRLEHECIINVIELIAASEPESIREVYLVLR
LMEMDLYKLIKTLRKRGQLIPHQHTSYWSYQILKALKYLHSANVLHRDLKPQNILINSST
DCALVICDFGLARVVDPDNPEKLSEYVATRWYRAPEITVSTEYCDQAMDIWSVGCILGEC
ITGRPLFPSRNAVDHMNRVLDLVGSPSDDDLTWIPKESTRSYLKRLDKKTRADFATTFPG
ATPEALEMLEAIMQFDPRKRPSADKLIAFSYFHNSGYRDPNEEV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgccaatagcacgacaggtggggaggggtctgccatgcagcacatctctgcc
atggccaatggcgtgcacacggtccacggccacattatcgatgtgggacctcggtacggg
cactttcgcttcgtgggcgaaggctcctatggcgtcgtcgtctcggccaaggactcccag
acaggccagcgcgtggccatcaagaagatgctcctcaaagaacatctctctttctcgcgc
cgtaccctccgcgagatcaagatcctaacccgcctcgaacacgagtgcatcatcaacgtc
atcgagctcatcgccgccagtgagccagagtccatccgcgaggtctacctcgtcctccgc
ctcatggaaatggacctttacaaactcatcaagacccttcgcaagcgtggtcaactcatc
ccccaccaacacacatcttactggagctatcaaattctcaaggccctcaaatacctgcac
tctgccaacgtcctccaccgtgacctcaagccccagaacatcctaatcaacagcagcaca
gactgcgcgctcgtcatctgcgactttggcctggcccgcgtcgttgacccagacaacccc
gaaaagctctcggaatatgtggccacccggtggtatcgggctccagagatcaccgtgtcc
accgaatattgcgaccaggccatggacatctggagtgtgggctgcatcttgggcgagtgc
atcaccggccgaccacttttccccagccgcaatgcggttgatcatatgaaccgcgtgctg
gatcttgtgggctcacccagcgatgacgacctcacctggatccccaaggagagcacgcgc
agctacctcaaacgcctagacaaaaaaacgcgcgccgactttgcaaccacctttcccggg
gccacacccgaggctcttgaaatgctcgaagctatcatgcagtttgaccctcgcaagcga
ccaagcgcggacaagctgatcgccttttcctactttcacaactctggttatcgtgatccc
aatgaggaggtgtga

DBGET integrated database retrieval system