KEGG   Monosiga brevicollis: MONBRDRAFT_35996Help
Entry
MONBRDRAFT_35996  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
mbr  Monosiga brevicollis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 128 aa AA seqDB search
MSWQTYIDQSLLGSGHVSKAAIHGHDGNPWATSAGFNVTQEEAVAAFRGIADPGPLTMSG
IKLGGQKYMFLRNNDGRSVYGRKGGDAGCVVVKTGKAIVIGIYEGGLQAGACANVVESLG
DYLINAGF
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaaacgtacattgatcagagcctccttggctcgggccacgtctccaaggct
gccattcacggccacgacggcaacccctgggccacctcggctggcttcaacgtcactcag
gaagaggctgtggcagcgttccgcggcattgctgaccctggacctctgaccatgtcgggc
atcaagcttggtggccagaagtacatgttcctccgcaacaacgacggccgttccgtctat
ggccgcaagggtggtgatgccggctgtgttgttgtcaagactggcaaggccattgtcatt
ggtatctacgagggtggtctccaggctggtgcctgcgccaacgttgtggagtcgctcggt
gactacctcatcaacgccggcttttaa

DBGET integrated database retrieval system