KEGG   Monosiga brevicollis: MONBRDRAFT_36751Help
Entry
MONBRDRAFT_36751  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
mbr  Monosiga brevicollis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MONBRDRAFT_36751
   03420 Nucleotide excision repair
    MONBRDRAFT_36751
   03430 Mismatch repair
    MONBRDRAFT_36751
   03440 Homologous recombination
    MONBRDRAFT_36751
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 837 aa AA seqDB search
MLVVGLMSGTSCDGIDAALVDVPADLAQGRRPAPGAVRLIAHTTVPYESDLQRRLRTLSS
AQAAVTLAEICRLNVMLGQAFAAAVHSLMDSPATNQAGISLRDVDLIGSHGHTVCHLPPG
AEGSTAPEAVDAANTICGTMQLGEAAVVAHDTGCVVISDFRTPDLAAGGQGAPLIPFVDQ
LLLAEAGRARAIVNIGGIANITLLTANGSVVGFDTGPGNMLVDMAVARLISADLRYDPEG
SLARQGQIQTALLERLLQHPFLQRTGPKSTGREDFGALYLDQILREDLVGTLAPHDVLAT
LTEFTAVTIASGITLAISNEENGQSPPASGSDALQVLVAGGGVHNLFLMERLQHHLPHAT
VASYEAVTGLSADAREAVCFALLAVHAYHRVPNTLASTTGASCPTIGGKISYPPPARVAQ
HTRRRSSQTRPRGTPAAAGPLAAPRTISTAAAQPPNWTAPNPMALPLGPDSELSLQGSPQ
LAYMLTYGSYMSPRSSVRGPVVPGLPPALNTTVAPQRVATTQPLNAGLTRVEGLMPVSVC
QLRSATKNGEHYRLNNQDIDKVMIVGVIRSVDARATRVTYTVEDHTGAISATRWSSNAGD
EEESSAAPDLYRENDYVQVVGQLRSDNENNLQLTAYNISKLTNGNQLTHHLISIVHAHLR
LTKPLSIVCHLLHHQARRCRIPGIPCNFSQQCLCVPVEIGRQRAGCGPGYNLQQCQRCQR
YAHRFFSCGRNWQWSAWWAGPVRQLNAALHATSAAVKIKTEDYSAGNSAMMTDSDVSGPD
GKVLQAFRHTTEEAGMSIEAVVAVTGLPESTVRSAIDTLSSEGQIYSTIDDEHFLAT
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgctggtggtgggattgatgagtggcacatcctgtgatggcattgatgcagcactggtg
gatgtgccggccgatctggcccagggtcgacgtccggccccgggtgccgtccgcttgatc
gcgcataccaccgttccctatgaatcagacctccagcgccgtctgcggacgctcagctcc
gctcaggccgccgtcacgctggccgagatctgccggctcaacgtcatgcttggccaagcc
tttgctgccgccgtccactcgttgatggattcgccggccaccaaccaggccggcatctcc
ctgcgcgacgtggacctcatcggtagccatggacacactgtatgccacctgccgccaggc
gcagaaggttccaccgcccctgaggctgttgatgctgccaacaccatttgtggcaccatg
caacttggcgaggccgcggtcgtggctcatgacacgggatgcgtcgtcatttcagatttt
cgcacccccgacctggcggccggtggccaaggtgccccgctcatcccctttgtcgaccaa
ctcctcctggccgaggccggccgagcccgtgccatcgtcaacattggaggcatagccaac
atcacgcttctgaccgccaacggcagcgttgtgggctttgatactggccctggcaacatg
cttgtcgacatggccgtggcgcgcctcatctccgccgaccttcgatacgaccccgaaggc
tccctggcacggcagggtcagatacagactgctcttctcgaacgtctcctgcaacatccc
tttttgcaacgaacgggcccaaagtcgacgggccgcgaagactttggtgccttatacctc
gatcaaatcctccgcgaggatcttgttggcaccctggccccgcatgacgtgctagccacc
ctaactgaatttaccgccgttaccattgcctcgggcattaccctggccatctccaatgaa
gagaacggccaatccccaccagcctcgggctctgatgcactccaagtcctcgtcgccggt
ggaggcgtgcacaacctttttctcatggagcgtctgcagcatcacctaccccatgccacc
gttgcaagctacgaagccgttacgggcttgagtgcagatgcccgggaggccgtttgcttt
gccctgctggctgtgcacgcttatcaccgtgtcccaaatacccttgccagcactacgggt
gcatcatgcccgaccattggcggcaagatctcctaccccccgcctgcccgcgtggcacag
cacaccaggcggcgctcctcgcagactcgtccccggggtaccccagccgctgccggacct
cttgctgcacctcgcacgatctcgacagcggcggcccagccccccaactggacggcgccc
aatcccatggctctcccgctaggacccgacagcgagctttccctacaaggatcgcctcaa
ttagcctacatgctcacctatggctcgtacatgagccctcgttctagcgttcgtggaccc
gttgttccaggccttccacctgcactgaacacgactgtagcaccacagcgggtggccact
acccagcccttgaatgctggtctgacccgtgttgaaggcttgatgccggtctctgtttgc
cagctgcgctcggccaccaagaacggcgagcactatcgtctcaataatcaggacatcgac
aaggtgatgatcgtcggtgtcattcgcagcgtggatgcaagggcaactcgtgtcacctac
accgtcgaagaccacactggtgccatctcagccacgcggtggtctagcaacgccggcgat
gaggaggaatcctcggctgcgcccgatctctatcgcgagaacgactacgtgcaggtcgtt
ggacagcttcgctcagacaatgagaacaacttgcaactcacggcgtacaacatctccaag
ctgaccaacggcaatcagctgacccatcacctcatcagcatcgttcatgcccatctccgc
ctgaccaaaccgctgtctattgtgtgtcacctgctgcatcatcaagccaggcgttgccga
ataccaggcatcccttgcaacttctcacaacaatgcctttgtgtgcctgttgaaatagga
cgccaacgcgctggctgtggccctgggtacaacctccaacaatgccaacgatgccaacgg
tacgcccatcgattttttagttgtggccgtaactggcagtggagcgcatggtgggctggg
ccggtgcgtcaactcaacgctgctctccatgcaacgagtgcagccgtgaagatcaaaacg
gaggactacagcgctggcaacagcgccatgatgaccgactcggacgtgtctggtcccgat
ggcaaggtcttgcaggcgttccgccacacgacagaggaggctggcatgtccattgaagcc
gtcgttgccgtgactgggctgcccgagtccaccgtcaggagtgccatcgacacattgtcc
tcagaaggtcaaatctactcaaccattgacgacgagcatttcctggcgacttaa

DBGET integrated database retrieval system