KEGG   Monosiga brevicollis: MONBRDRAFT_37086Help
Entry
MONBRDRAFT_37086  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mbr  Monosiga brevicollis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mbr01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mbr00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 447 aa AA seqDB search
MSRLTPPEAPHRRLAEKGHEQAAIEQVLRAVTLEPALRAELQAAATTTVNARLHIVSDAN
TVFIAEILQANDLTAVFGDRIFTNPGRFDNVQELHFFLACGLDRWCTLSCCCCDDDANDD
DDVCHATKTSELASSAGMGWGKVRSGIDAVHRVEVDCPEFLKEPKTCAIVGAPFTYGQPR
YGVDNGPEALRDAGLMEALLRLGWRAYEHGDITFESPARGNPRYEGPGSCKHPYVVGEAN
RQIAEVCEEHAREGRFVLTLGGDHSIGVGTIAGQLLVRPETGVIWVDAHADINTPALSGS
GNMHGMPLAFLSRLVAPEEVPGFDWLKRVPALDPSTQLVYIGLRDVDKPERDIIRQHNIK
AFTMSHVDKFGIGKVMEMALDHLGERPLHLSYDIDACDPAIAPSTGTAVRGGLTYREAHY
VAEAANETHRLASMDLVEVNPTFNGEM
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtctcacaccgccggaagcgcctcatagacggctggctgagaagggccacgag
caggcagctattgagcaagtgttgagggccgtgacactcgagccagccctccgagccgag
ctgcaggcagcggccacgaccacggtcaatgcgcgactgcacattgtttcggatgccaat
acagttttcatcgcagaaatcctgcaggccaatgacttgactgccgtctttggtgaccgc
atctttacaaacccgggccgctttgacaatgtgcaagagcttcatttttttttggcttgt
ggtctggatcgctggtgcactttgagctgctgctgctgcgacgacgacgccaacgacgac
gacgacgtatgccacgccaccaagaccagcgaactcgccagctcagccggcatgggctgg
ggtaaagttcgctccggtattgacgccgtccatcgcgttgaggtggattgccccgagttt
ttgaaagagcccaagacgtgtgccattgttggtgcccccttcacctacggtcaaccccga
tatggtgtcgataacggacccgaggctttgcgtgacgctggcttgatggaggccctgctc
cgtctgggctggcgtgcttacgagcacggtgatattacctttgaatcacccgcccgtggc
aaccctcgctatgagggcccgggatcgtgcaagcatccctacgtggttggcgaggctaac
cgccagattgccgaagtgtgtgaggaacatgcccgcgagggccgcttcgttctcaccctc
ggcggtgatcactccattggcgtcggcaccattgctggccaattgctcgttcgcccagag
actggcgtcatctgggtcgacgcccacgccgacatcaacaccccggccctctccggatcg
ggcaacatgcacggcatgcccctggccttcctctcgcgcctcgtcgcccccgaagaggtg
cccggctttgactggctcaagcgtgtacccgccctcgacccctcgacccaactcgtctac
attggcctccgtgacgtcgacaagcccgagcgcgatatcattcgtcaacacaacatcaag
gcctttaccatgtcccatgtcgataagtttggcattggcaaggtgatggagatggcactt
gaccatttgggcgagcgtcccctgcatctgtcgtatgacattgatgcttgcgaccctgcc
attgccccttccacgggcaccgcagtccgtggtggtctcacctaccgcgaggctcactac
gttgccgaagccgccaacgagacccaccgcctcgcatcgatggatctcgtagaggtcaac
cccaccttcaacggcgagatg

DBGET integrated database retrieval system