KEGG   Monosiga brevicollis: MONBRDRAFT_37222Help
Entry
MONBRDRAFT_37222  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mbr  Monosiga brevicollis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MONBRDRAFT_37222
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MONBRDRAFT_37222
   00020 Citrate cycle (TCA cycle)
    MONBRDRAFT_37222
   00620 Pyruvate metabolism
    MONBRDRAFT_37222
Enzymes [BR:mbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MONBRDRAFT_37222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 444 aa AA seqDB search
MLLLPKMLVGSLRTRLSTSPVAATLRQLSVLGSAVTMRQSLRQVPILAQSRLYASDLPSH
IVVNFPALSPTMTTGTLMEWQVAVGDEVAAGDALGQVETDKAAMAFESTEDGFVAKLLVE
DGTSDIAIGQPVMVLVEDKDDIPAFENFTPEASATPEPKKEEPKAEPEPAKDSQPATPAP
TPAPSPSTTEKSGDRIFASPLARRLAAQAEIALDQLNGSGPRGRITRADVEAYQQSAPAP
AAGASTSTKAASPAGSDDLEYTDVPLSNMRKVIAKRLQESKQQVPHYYLTSDVNVDAVLA
LRQQFNAEANGEYKLSVNDFVIKASAAALQDVTECNSAWMDTFIREYDSVDISVAVSTDA
GLITPIVFDADLKGLREISENVKELAGRAREGKLAPEEYQGGTFTISNLGMYGVSSFSAI
INPPQACILAVWWYGTARHCGRFH
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgttgcttctgcccaagatgcttgtcggcagcctgcgcactcggctgtcgaccagtccc
gtcgcggcgaccctccgccagctgagcgtgctcggttctgccgtaacgatgcgtcaaagc
ctgcgccaagtgccgattctcgcccagtcccggctttatgcctcggatcttcccagccac
attgttgtcaactttcccgctctctccccaaccatgacgactggtaccctcatggagtgg
caggtagccgttggcgacgaggttgctgccggcgatgccctgggccaagtggagacggac
aaggctgccatggcatttgaatcaactgaagacggctttgtggctaagctcctcgttgaa
gacggtacctccgacattgccattggacagcccgtcatggtcctggtcgaggacaaggac
gacattcctgcttttgaaaacttcacccccgaagcctccgccacccccgaacccaagaag
gaagagccaaaggcggagcctgagcctgccaaggactcacagcctgccaccccggctcct
accccggctcctagcccatccacaaccgaaaagtctggtgaccgcatttttgcctctcct
ttggcccgacgccttgctgcccaggccgagattgctctggatcaactcaacggcagtggc
cctcgtggacgcatcactcgtgccgacgtggaggcttaccaacagtccgctcccgctccc
gctgccggtgccagcaccagcaccaaggcggcctcgccagccggctcagatgacctcgaa
tacactgacgtgcccctcagcaacatgcgcaaggtcatcgccaagcgcctgcaagagtcc
aagcagcaagtgccgcactactacctcactagtgatgtcaacgtggatgccgtcttggca
ctgcgtcaacagttcaacgccgaggccaacggtgaatacaagctctccgtcaatgacttt
gtcatcaaggcctctgcagccgccctgcaggacgtcaccgagtgcaactcagcctggatg
gataccttcatccgcgagtacgactctgtggacattagcgtggccgtcagcaccgacgcg
ggcctgatcacccccatcgtctttgacgctgacctcaagggtctgcgtgagatttctgag
aacgtcaaagagctggctggccgtgctcgcgagggcaaacttgcccccgaagagtaccaa
ggtggcaccttcaccatctccaacctcggcatgtatggtgtttccagcttttctgccatc
atcaacccgcctcaagcctgcatcctcgcggtttggtggtacggaacagcgcgtcattgt
ggacgcttccactga

DBGET integrated database retrieval system