KEGG   Monosiga brevicollis: MONBRDRAFT_37635Help
Entry
MONBRDRAFT_37635  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
mbr  Monosiga brevicollis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 227 aa AA seqDB search
MEPPNHEDDEPLGPHLVWADAVTTIELYTNRQEVESGEGDVCYPEYTHQVFGETEKIYGY
DNLRVRLLYGAGSLLTSLCIEYGQRVESDETGVEADNVEAAMLEWLPEEEPCLRGVEAFK
AAVDQAEAKFTPPGIKQHEYHDHAGNTIEVYLGRPSDPSVHAYHQRAQTFTLWAIEAASY
IDLEDDKWHMLYAFMRIPEGDGFRHALVGFVTLYTYYAYPANLRPRI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgccgaatcacgaggacgacgagccactgggcccgcaccttgtctgggccgac
gccgtcacgaccattgagctctacaccaatcgtcaagaggttgagagcggcgagggcgat
gtgtgctaccctgagtatactcaccaggtctttggtgaaacggagaaaatctatggttat
gacaatctgcgcgttcggcttctatacggtgccggaagcctgttgacgtcattgtgcatt
gaatatggccagcgcgtggagtcagacgagacgggcgtggaggctgacaatgtcgaggca
gctatgctcgagtggctgcccgaagaagaaccgtgcttgcgtggagttgaggccttcaag
gcggccgtggatcaggcagaagccaagtttacacctcccggcatcaagcagcacgagtat
cacgatcatgctggcaacaccattgaagtgtacctgggtcgaccttctgatcccagtgtt
catgcctaccatcaacgcgcccagacgtttaccctgtgggccatcgaggccgccagttac
attgatcttgaggacgacaagtggcacatgctttacgcgtttatgcgcattccagagggg
gacggctttcggcatgcattggtgggctttgtcaccctgtacacgtattatgcctatccg
gccaacctgcggccacgcatc

DBGET integrated database retrieval system