KEGG   Monosiga brevicollis: MONBRDRAFT_38117Help
Entry
MONBRDRAFT_38117  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
mbr  Monosiga brevicollis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 2556 aa AA seqDB search
MSDTQIGDDIDVDDGDLESLDVPSEDHNLNVNSGFSEDHTMNTDADEDPFHRNVDAMEDM
RLSLRLECNPMLAHYQRMLSSLSKCSSQEGPDSPLPVSNQRDEKLVTIRSAIEEGAPYLS
LDHRLLEPDYETNNVQLDLNWTALKTLQRPEDGPYRVPEVLMTTIESQLQGRWSILVLQN
EPLGVAMQAAILALNETDALHADAQLNRFLAVLLPDAFDKLLTSSALYNWDLSTFQRIQR
LINILLRLCIKLIPYDNVIVGDMLAKVKRLTENLLHHPCSAAEIVILTGLTRPFACIDAV
EGNIISCFEAIFASTVNLVEHSDPLREAAAESNACAKLLEMLYDLAQDARKNQICTKMAS
FNASAFVIGSIITTFLSVLYKTACTKLNMSSDELLQRFFEKFRDLWVRVNAENNSKLLKL
CFERALVRSDDVINVIVANLKAYWAHCREVLQDQPENEDPDTILLDVLFDGVAYAEVVSK
YLDAIACILKVNYDEHRLSSARLNLVHVQQSHLIGLDKLWELVAACCCFGHRVRYALRFE
THELVNRMYPPPTLCAACVYSLEHHQLGYFFDVLARFMGALNALGLPMQAVPVPPQLSYV
VLRDTVHEEQVGSDAVNQSANSVLDPQKQESENVESWTTGSKHADARQVDKNGDIHRNNR
GASPSDTGENGDDTNSARTGRRGALFETDENDPGLQGNDDDPAAFAVGRQSLAAAGTVVG
TSMAGPSNHLQPSFEPQHEPITEDNFDSNKASRRNSLQSTGDMNDFEDMTYDSQSLPADP
SRASPMSEWSKEAPPLIQTSESKSHPELQGQAQSEADGLDRVDEAQDAFPQKMPQNHESD
SATTSRTTSIEQCVEPHHFEASDFMTSLLRVTRSLAILADIIKSHNDMNEVLRSELPHAC
AHRGRDVLLTVQQRDGRCRFLVRAHTHEPAMFIRNQIANFLQQQVQSVHLSINDQYLRSS
DLSKSLRELSVTSDAIVTVSEENGLYEQHFRPSEQCSSLALVYRLRALKQLLQPAYVCNR
DEAMTQMRLRCAFLKSHAAQTLFALLQQPFDNVSDAREASSFLEIKVICLDTILDVMRQA
LAPSTEIVVPVMSAVRSQTGDFRGTALIEDVAAGAAGDGVVVSFQYPMQDGLQLVPEEAH
SSGARAMPMEPDLTRQLFQNRSFNDEFFQCCKRLVCQACRQEFSQSGEDGSAIRGPMRQD
SQLLATVTRPSSPAVRLIHQLALDLMQLSVQAGLTRPSTLGLDGSDRDFLLLGLVHASPA
IFRSRFGRFLRHAMGLNLEEGTARSDPHPLAVAPLEEAEVASIAQRVFEVLYDAVPACWE
PAPSDSGRYEELLGLLVDLLARTQVEATKAHGEPMPLDPQHIFEREAEWLQRFVACRDAR
AGAAHEHGDDPGATAQGAVAMSEDEQQPFDRHETNPSPGRLQAPTPKASTARFLEGHVKL
FKEAFGRTHAEYCAAFVQDHNFHMFLLTTALLGAGSALQAPQEAPTSAAPLFVDASIRDT
LFSLLASIVQVSVPALNEVCTWCKTHMLDPVIPHGVGWTVQIERRQHAVGLRNGGATCYM
NSLFQQLFMQPSLRRALIDIPTQTRGFFAQQALAQSNSDTAQLRLSMDDRLVDKYVHGAQ
TENTLLQLQRIFAHLNSDAKSVSLGPDLLTSPRLERIRVHAVRILGSCHCDFSAQSKSVV
CCWLCLGLQFYSPELFWATFKLWGEPINVRVQSDAVEFLQTLVDQTDELLQSAGAAPILA
PLLKFEMITQIIGKSCRHTSERHEDTFNLSLPVMSHDTMHEALLDSVQGEMFTGANQYRC
QECGVKVDAMKRSCIKTLPPMLMVQLKRFGYDLQTFQPVKHNVRFEFPQELDLEPYTYGY
LTQKERQEAQEAASDADNAADAVDLGPANSEGVSPAEIPPCCKYRLQGVVVHMGSASAGH
YYSFSRTRETPTTLADGSAGKWLKFNDEQVTEVIVNRDLCEDQFYGGGTTYNTEYGTFEK
NYSAYILVYERLDVLEELRQGQSLNPSPQPPPVQTPAEVAMLDGFEVPPQLSAEIQAGNL
RFEFLHQLLSPSFAGFLTTLVQQGLYTPPVVLATQALLRVGLRVATAVWASSEELIKSVT
MSLANPIFAVAVREVLAADGALVTDLLQALRNGVMRSRLLELVETAMTSLPAESEISAGL
RMPYGPVIQALLAADLPVDHDGCAPLLSTLFCILRQVPAGLRPDCCLDAIAGYASRLLLS
EDGSLNGPGTLIPEVSAKLRELVSILCQYSNLCAHHDDDTVPVRGSTNPDIDNFMPGKPR
DRVEQPALLVGEPPLAPLSDNLARVIFHADFVRFMFDSEQLEDPVLEQALLHLAFGNRRL
SLIILHEYMTAFARRQLPFQGLMAWLSAFWALRDGLDEWRQKLILHGGEVQDAGGYVGSV
KKTRGLVKLVEGNEQVAVRYRYLKVLLALGEQHPGLMTLVPGSVCLALQVAADEMNTIAT
PAYSVSDNNETWNQNRLVRSDSFRTTMTLVRNVLKPTETEAQGSLEIPSATNGEAQSNGS
ALNDENELVGDVWTSMPMDRMSPHSETDMIENESEA
NT seq 7671 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacactcagattggtgacgacattgatgtcgatgatggggatttggaatctctt
gatgtgccctcggaggaccacaacctcaatgtgaattctggcttttctgaagaccacacc
atgaatactgatgccgatgaagatccctttcaccgcaatgttgacgccatggaagacatg
cgtttgagcctcaggctcgaatgtaaccccatgctcgcacattaccagcgcatgctctca
tccctgtcaaaatgcagctcgcaggagggtccggattcgccgctgcccgtcagcaaccaa
cgcgacgaaaagctggtgacgattcgtagcgccattgaagagggcgcaccttaccttagt
ctcgaccatcgactgctcgagccagattatgagaccaacaacgtccaactcgacctcaac
tggactgcactaaaaaccctccaacgccccgaggatgggccttatcgtgttccagaggtg
ctcatgaccaccatcgaatcgcagctgcagggtcgatggtcaattttggtgcttcaaaat
gaacccttgggggtagcaatgcaggccgcgatcctagcgctcaatgaaaccgatgccctc
cacgctgacgcgcaactcaatcgttttttggccgtcctccttccggacgcctttgacaag
cttttgacgtcaagcgcgctttacaattgggatttaagcacctttcagcgcattcagcgg
ctcatcaatatacttcttcgcctgtgcatcaaactaatcccctacgacaacgtcattgtc
ggcgacatgcttgccaaggtcaagcgattgacagagaacttgttacatcacccatgctct
gctgcagaaatagtcattctcactgggctcactcggccgttcgcgtgcattgacgccgtg
gagggaaacatcatctcctgctttgaagccatcttcgcaagcaccgtcaacttggtggaa
cactccgacccattgcgtgaggcagcagctgaaagcaacgcgtgcgcaaaactgttggag
atgctgtatgacctggctcaggacgctcgcaagaaccagatctgcaccaaaatggcgtcg
ttcaacgccagcgcctttgtgattggatcaatcatcaccacattcttgagcgtgctctac
aagacggcatgcaccaaactcaatatgtcgagcgacgagctgttgcaacgtttttttgaa
aaatttcgtgatttgtgggttcgcgtcaacgccgaaaataactccaagctgctcaagctc
tgctttgagcgtgcgctggttcgatcggatgacgttatcaacgtcatcgttgccaatttg
aaagcctattgggcccattgtcgcgaggtgcttcaagatcaacctgagaacgaggatcca
gacaccatccttttggatgtcctttttgatggtgtggcgtatgctgaagttgtttcaaag
tacctggatgccattgcttgcattctcaaggtcaattatgatgagcatcggctctcctcg
gctcgcctgaatctggtccatgtgcagcaaagccacttgatcggtctcgacaagttgtgg
gaactcgtggcggcctgttgctgttttggtcatcgtgtgcgttacgccttgcgatttgaa
actcacgagttggtcaatcgcatgtaccccccacccaccctctgtgctgcctgtgtgtac
agcttggagcaccaccaattgggctacttttttgatgtgctggcgcgcttcatgggtgct
ctcaatgccctaggacttcccatgcaagctgttcccgtaccaccacaactctcctatgta
gttttgcgcgacactgtgcatgaggaacaagtgggctccgatgcggtcaatcagagcgcc
aacagcgtcctcgaccctcaaaagcaagagagcgaaaacgttgagagctggaccactgga
tcaaaacatgctgatgcccgccaagttgacaaaaacggtgacattcatcgcaacaacaga
ggcgccagtccaagtgacacgggcgagaatggcgacgatacaaattcggcaagaacggga
cgacgcggcgccctctttgaaaccgacgaaaatgacccagggctgcagggcaacgatgat
gacccagctgcatttgcggttggccgccaatcacttgccgcggcaggcaccgtagtcggc
acaagcatggccgggcccagcaatcatctgcaaccctcattcgaaccgcagcatgagcca
atcactgaagacaactttgacagcaataaggcatcgcgtcgaaactcactgcagtccacg
ggtgacatgaatgattttgaagacatgacctacgattcccagtcactgcctgcggatcca
agtcgcgcgagtcccatgtcggagtggagcaaagaggcgcccccattaatccagacttcc
gagtcaaaatcacatccagaactgcaaggacaagcacagtctgaagctgatggactcgat
cgcgttgacgaggcgcaagacgctttcccgcaaaaaatgcctcaaaatcacgagtctgac
tcggcaaccacatcgcgcacgacctcgattgagcaatgcgtcgagccacatcattttgag
gcgagtgatttcatgaccagcttgctgcgtgttacgcgctctttggctattttagccgac
attatcaagagccataacgatatgaatgaggtgttgcgctctgagctcccccatgcgtgc
gcacatcgcggccgtgatgtgctactgactgttcagcagcgtgatggccgctgtcgcttt
cttgttcgcgcacacacccatgaacctgccatgttcatccgcaaccagattgccaacttc
ttgcagcaacaggtacagagcgtacatctgagcatcaacgaccaatacttgcggagcagc
gacttatctaagtcgcttcgagaactaagcgtgacaagtgatgccattgtaaccgtgtca
gaggaaaatgggctctatgagcaacacttccgaccgtccgaacagtgttcaagcttggcc
ttggtgtatcgcctgcgtgctctcaagcagctgttgcagccggcatatgtgtgcaaccga
gacgaggccatgactcaaatgagacttcgctgcgcattcctcaagagccatgccgcccag
acactgtttgcgctactgcagcaaccttttgacaacgtgtctgacgcgcgcgaggcttca
tcctttctcgagatcaaagtcatttgcctggataccattttggatgtgatgcgccaggcg
cttgcccccagcacagaaattgttgtgccggtaatgagtgcagtgcgctcgcaaaccggg
gattttcgaggcacagcgctcattgaagacgtagcggcaggggcagctggcgacggggtt
gtggtcagctttcagtatcccatgcaagacggtttgcaactggtgccagaagaagcccac
agcagcggcgcccgcgccatgccgatggagcctgacttgacgcgccaactctttcaaaac
cgctccttcaatgatgagtttttccaatgctgcaagcgcttggtttgccaggcttgtcgc
caggagttttctcaatcaggcgaagatggctcagcaatacgaggcccgatgcgacaggat
tcacagcttctcgccactgtcacgcgtccttcaagcccggccgtccgcctcattcatcag
cttgcgctggatctaatgcagctgagcgtgcaagctgggttgacacgcccctcaaccctg
ggccttgatggcagtgaccgagactttttacttctcggccttgtccacgcttcccctgcc
atctttcgcagccgttttggccgtttcttgcgccacgcaatgggtctgaaccttgaagaa
ggtacagctaggagcgacccgcacccgctagccgtggcacctttggaagaggccgaggtg
gcttcaatcgcgcagcgcgtctttgaggtgctgtacgacgcagttccagcatgttgggaa
ccagccccaagcgattccggccgctatgaggagcttttgggactgcttgtcgatctgctg
gcacggacgcaagtggaggctaccaaggcccacggggaaccgatgcccctcgatccccag
cacatctttgagcgcgaggcggagtggttacaacgctttgtcgcgtgtcgcgatgcccgt
gcgggcgctgcacacgaacatggagatgaccctggtgctacggcccagggcgctgtggca
atgagcgaggatgaacagcagccctttgatcgccatgagacgaatccgtcaccgggacgc
ttgcaagcaccaacgcccaaggcttccacggctcgctttttggagggccatgtcaagctc
ttcaaggaggcttttggacgcactcacgccgagtattgcgcagcctttgtccaggatcat
aactttcacatgttcctgctgaccaccgctttgttgggtgcgggcagtgcgctgcaagcg
ccacaagaggcgccaaccagcgccgcgcctctgtttgtcgatgctagcattcgcgatact
ctcttctcgctgttggcaagcattgtgcaagtgtccgttcctgcgttgaacgaagtttgc
acgtggtgcaagacccacatgctcgacccagtcatccctcatggtgtgggctggaccgtg
caaatcgagcgccgccaacatgccgtcgggcttcgcaatggcggtgccacctgctacatg
aactcactttttcaacaactctttatgcaaccctctctacgccgtgccctcatcgacata
ccaacgcaaacgcgcggcttctttgcccagcaggcgctggctcagagtaacagtgatacg
gctcagctcaggctcagcatggacgaccgcctggtcgataagtatgtgcacggcgcgcaa
acggaaaatacgctgctacaactgcaacgcatatttgctcacttgaacagcgacgccaaa
tcggtcagtcttggccctgatctgctcacttctccccgcttggaacgtattcgcgtacac
gctgtccggatcctcggatcctgccattgcgacttttcagctcagtcgaaatctgtggtc
tgttgttggctgtgcttgggactgcagttttattcgccggagctgttctgggcgacattc
aaattgtggggcgagcccatcaatgtgcgagtgcaaagcgacgctgtggagtttcttcaa
acactggtggaccagaccgacgaattgctgcaatcagctggtgcggcgccaattttggcg
cccctcctcaagtttgagatgataacccagatcattggtaaatcgtgccgtcatacgtct
gagcgacacgaggacaccttcaacctgtcgctgcccgtcatgtcccacgacacaatgcac
gaggcactgctggattcggtccaaggggagatgttcacaggcgccaaccaatatcgctgc
caagagtgcggtgtcaaggtggacgccatgaaacgctcatgcatcaaaacgctgcccccc
atgctcatggtacagctgaagcgctttggctatgatctgcaaacattccagcccgttaaa
cacaacgtgcgctttgaatttcctcaggagctcgatcttgagccgtacacttatggttat
ttgacgcaaaaagaacgccaggaggcacaagaggcggccagtgacgcagacaatgccgca
gatgctgttgatcttggtccagccaactctgaaggggtttccccagcggaaattccgccc
tgttgcaagtatcgcttgcagggtgtggttgtgcacatgggcagtgccagcgccggacac
tactacagcttttctcgaactcgcgagaccccaacgacgctggctgatgggagcgctggc
aaatggctcaaatttaacgatgagcaggtgactgaggtcatcgtcaatcgcgatttgtgt
gaagaccagttttacggtggtggaactacttacaacacagagtatggtacctttgagaag
aattactcggcctacattctcgtgtatgagcgcctagacgtgctggaagagctgcgccag
gggcagagcctgaaccccagcccacaaccaccaccagtacagacgcccgcagaggtggcc
atgctagatggcttcgaggtccccccccagctgtcggcggagattcaagctggcaacctg
cggtttgagtttcttcaccagctgctgtcgccatcctttgctggctttctgacgactctg
gtgcaacagggactgtacaccccaccagtcgtcttggcaacacaggccctgctgcgcgtt
ggcttgcgcgtcgcaacagcggtctgggcctcttccgaggagctcatcaagagcgtgaca
atgagtcttgccaacccaatttttgcagtggctgtccgtgaggttctggccgcggacggc
gcgctcgttaccgatctcctgcaagcccttcgtaacggcgtcatgcgctcacgtttgctt
gagttggttgaaacggccatgactagcctgcctgccgagtccgagatcagcgcaggctta
cgcatgccctatgggccagtcattcaggccctgttggcggcagacctacctgtggatcat
gacggctgcgcgccacttctttctaccttgttctgcatcctgcgccaggttcctgccgga
ctgcggcctgactgttgcctggatgccatagctggctatgcatcccgtctgttgttgtct
gaagacggttcgctcaacggcccaggcacgctgataccggaggtctcggccaagttgcga
gagctagtgagtatcttatgccagtacagcaatctctgcgcccaccacgacgatgatact
gtccccgtgcgcggcagcacaaaccccgacatcgacaacttcatgccaggcaaaccacga
gaccgggttgaacagcccgctctccttgtaggagagccgccgctggcaccgttgtcggat
aatctcgcgcgagtgatattccacgcagattttgtgcgctttatgtttgactcggagcag
ctggaagacccggttttggagcaggcgttactgcatcttgcgtttggtaatcgacgcctc
tcactcataatcttgcatgagtacatgacggcatttgcccggcgccagctgccctttcaa
ggtctgatggcttggctctcggccttttgggctttgcgcgacggcctggacgagtggcgg
caaaagcttatcttacatggcggtgaggtgcaagatgctggaggttacgtcgggtctgtg
aaaaaaacccggggtctggtaaagctcgtagaaggcaatgagcaagttgcggtgcgatac
cgctatctgaaggtgttgctggcactcggcgagcagcacccagggctgatgacgcttgta
ccaggctctgtgtgcctggccttgcaggtggccgccgacgaaatgaatacgattgcaaca
ccggcatacagcgtctccgacaacaacgaaacctggaaccagaatcgcctagttcggtca
gattcttttaggacgacgatgacgctagttcgcaacgttctgaagcccaccgaaactgag
gcacaaggctctttggagatcccatcggcgacaaacggcgaggcgcagagtaatggctct
gccttgaatgatgaaaatgagttggtcggtgacgtctggacctcgatgcctatggaccga
atgtcgccacacagcgagaccgacatgattgagaacgagagtgaagcctga

DBGET integrated database retrieval system